KEGG   Rhizobium grahamii: FZ934_25305Help
Entry
FZ934_25305       CDS       T06285                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rgr  Rhizobium grahamii
Brite
KEGG Orthology (KO) [BR:rgr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FZ934_25305 (ahpF)
Enzymes [BR:rgr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FZ934_25305 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 NAD_binding_8 Thi4 FMO-like AlaDh_PNT_C K_oxygenase NAD_binding_7 Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QFY63561
UniProt: A0A5Q0CH78
LinkDB All DBs
Position
unnamed:complement(1381793..1383373)
Genome map
AA seq 526 aa AA seqDB search
MLDEALKSQLKSYLERVVRPIEIVASLDDSAKSRELSELLNALVSLCDKISVTELHGQNE
RAPSFALTSPGHDINLRFAGIPMGHEFTSLVLALLQVGGHPPRVEQAIADQIKDLDTDLT
FETYFSLSCQNCPDVVQALNLMAVLNPRIKHVAIDGALFPKEVESRQIMSVPTVYLNGQV
FGQGRMEIEEIVSKLDTNAAAKAAERLNDRAPYDVLVVGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMSIENFISVRHTEGPHFAAALEEHVRDYDVDIMNLQRASKLVAGKGLV
SVELENGAVLRSKTVIVATGARWRQMGVPGEDSYRNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLANIVQHVTLIEFDSKLRADEVLQRKLESLPNVDVVLSAKTTEVLGDGQK
VTGLVYENRIAGQRHTLNLDGIFVQIGLLPNTEWLKGTVDLSPRGEVVVDHHGQTSVPGV
FAAGDCTTVPYKQIVIALGEGAKASLGAFDYLIRHAETPADAVKAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaagccctgaaatcccagctcaaaagctatctggaacgcgttgtccgcccg
atcgagatcgtggcgtcgctggacgacagtgcgaaatcacgcgagctgtcggagcttctg
aacgcgctggtgtcgctctgcgacaagatctccgtgacggaattgcatggccagaacgag
cgtgcgccttcgtttgcgctgacaagccctgggcatgacataaacctgcgctttgcgggc
attccgatgggacacgaattcacatcgctcgttctggcactgctgcaggttggcggccat
ccgccgcgcgtcgagcaggcgattgcggaccagatcaaggatctggacaccgacctgacg
ttcgaaacctatttctccctgtcttgccagaactgccccgatgtcgttcaggctttgaac
ctgatggccgtattgaatccgcggatcaagcatgtcgccatcgacggcgcgctcttcccc
aaagaggtcgagagccggcaaatcatgtcggtccccacggtctatctcaacggtcaggtc
ttcgggcagggccgcatggagatcgaggaaatcgtttccaagctggatacgaatgctgcg
gcgaaggccgccgagcgcctcaacgatcgcgccccctatgacgttctcgtggtcggcggc
ggtcctgccggtgcggctgcagcaatctatgcggcgcgaaagggaatccggacaggtgtg
gctgcggaacgtttcggcggacaggtgctcgataccatgtcgatcgaaaacttcatttcg
gttcgtcataccgagggaccgcacttcgccgctgccttggaggaacacgttcgggactat
gatgtcgacatcatgaacctgcagcgcgccagcaagctggttgccggcaaggggcttgtg
tcagtcgaactcgagaacggagccgtgcttcgatcgaagaccgtcattgtcgccacaggc
gcgcgctggcggcagatgggtgtgcccggcgaagacagctaccgtaacaagggcgttgcc
tattgcccgcattgcgacggtccgctgttcaagggcaagcgggttgcagtcatcggcggt
ggaaactccggcgtggaagcggcgatcgacctcgccaacatcgttcagcacgtgaccttg
atcgaattcgattcgaagctgcgcgccgatgaggtgttgcagcgcaagcttgagagcctg
cccaacgtcgacgttgtgctctcggccaagacaaccgaagtgttgggcgatggccagaag
gtaacgggtctcgtctatgagaaccgcattgccgggcagcgacacacgctgaatctggac
ggtatcttcgtccagatcggcctcctgccgaatacggagtggctgaagggcactgtcgat
ctctccccacggggcgaggttgtcgtcgatcatcacggccagacgtcggtgcccggcgta
tttgccgccggcgattgcacgacagtgccttacaagcagatcgtcattgccctgggtgaa
ggcgcaaaagcgtctctcggtgcgttcgactatctgatccgtcatgcggagacgccggcg
gacgcggtcaaggccgcataa

DBGET integrated database retrieval system