KEGG   Rhizobacter gummiphilus: A4W93_02315Help
Entry
A4W93_02315       CDS       T04831                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rgu  Rhizobacter gummiphilus
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A4W93_02315
Enzymes [BR:rgu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A4W93_02315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored Glutaredoxin FAD_binding_2 HI0933_like NAD_binding_8 DAO FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ARN18849
UniProt: A0A1W6L3I3
LinkDB All DBs
Position
549817..551373
Genome map
AA seq 518 aa AA seqDB search
MLDDTLQSQLKTYLERVTQPFEIVASLDDGESSREMLALLKQVASLSAHITLKTDGTDAR
RPSFSLNRTGSDMKLRFAAIPLGHEFTSLVLALLWVGGHPPKVEAETIEQIKHLEGKYDF
EVYMSLTCHNCPDVVQALSLMAVLNPNISSVVIDGGLYQKEVEDRQIMAVPMVFLNGEHF
GQGRMSVEEIVAKLDTNAGARDAAKLNARDPFDVLIVGGGPAGAAAAVYAARKGIRTGVV
AERFGGQVLDTLAIENFVSVLATEGPQFAAALEQHTKHYDVDIMNLQRADKLVAGGDLIE
VHTEGGGVLKSKSVILSTGARWREVNVPGEKQYRNAGVAYCPHCDGPLFKGKKVAVIGGG
NSGVEAAIDLAGIVEHVTLFEFADQLRADAVLVKKLRSLPNVVIHTNAQTTEITGDGSKV
NGITWTDRVSGTSTQTALEGVFVQIGLVPNTEWLKGTVELSRHGEIVVDAKGATSIPGVF
AAGDVTTVPYKQIIIAAGDGAKAALGAFDHLIRTSVPA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgacaccctgcaatcccagttgaagacctacctcgagcgcgtgacgcagccg
ttcgagatcgtcgcgtcgctggacgacggcgagtcctcgcgcgagatgctcgccctgctg
aagcaggtggcctccctgtcggcccacatcacgctcaagaccgacggcaccgacgcacgc
cgcccgtccttcagcctgaaccgcaccgggtccgacatgaagctgcgtttcgccgccatt
cccctcggccatgaattcacctcgctggtgctggccctgctgtgggtgggcggccatccg
ccgaaggtcgaggccgagaccatcgaacagatcaagcacctcgaaggcaagtacgacttc
gaggtctacatgtccctcacatgccacaactgcccggacgtggtccaggcgctgagcctg
atggccgtgctcaatccgaacatcagctcggtcgtcatcgacggcggcctgtaccagaag
gaagtggaagaccgccagatcatggccgtccccatggtgttcctgaacggcgaacacttc
ggtcagggccgcatgagcgtcgaggagatcgtcgcgaagctggacaccaacgccggagct
cgtgacgccgccaagctgaacgcccgcgacccgttcgacgtgctgatcgtcgggggcggc
cccgccggcgcggccgcggccgtgtacgccgcgcgcaagggcatccgcaccggggtcgtg
gccgaacgtttcggcggccaggtgctggacacgctcgccatcgagaacttcgtgtcggtg
ctggccaccgagggcccgcagttcgccgcggcgctcgagcagcacacgaaacactacgac
gtcgacatcatgaacctgcagcgggccgacaagctcgtggccggcggtgacctgatcgag
gtgcacaccgaaggcggtggcgtgctgaagtcgaagtcggtgatcctgtccaccggcgcc
cgctggcgcgaggtcaacgtgcccggcgagaagcagtaccgcaacgctggcgtggcctac
tgcccgcactgcgacggtccgctgttcaagggcaagaaggtcgccgtgatcggtggcggc
aactcgggcgtcgaggccgcgatcgacctggccggcatcgtcgagcacgtgacgctgttc
gagttcgccgaccagctgcgcgccgacgccgtgctcgtgaagaagctgcgcagcctgccg
aacgtcgtgatccacacgaacgcccagaccaccgagatcaccggcgacgggtccaaggtc
aacggcatcacgtggaccgaccgcgtgagcggcacgtcgacgcagaccgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctcaagggcacggtggagctg
tcgcgccacggcgagatcgtggtggacgccaagggcgccacgtcgatccccggcgtgttc
gccgccggcgacgtgaccacggtgccgtacaagcagatcatcatcgccgcgggcgatggt
gcgaaggcggccctgggggcgttcgaccacctgatccgcacgtcggtgccggcctga

DBGET integrated database retrieval system