KEGG   Rhizobacter gummiphilus: A4W93_05720Help
Entry
A4W93_05720       CDS       T04831                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00550  Peptidoglycan biosynthesis
rgu01100  Metabolic pathways
rgu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4W93_05720
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A4W93_05720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rgu01003]
    A4W93_05720
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rgu01011]
    A4W93_05720
Enzymes [BR:rgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     A4W93_05720
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A4W93_05720
Glycosyltransferases [BR:rgu01003]
 Polysaccharide
  Bacterial polysaccharide
   A4W93_05720
Peptidoglycan biosynthesis and degradation proteins [BR:rgu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   A4W93_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ARN19448
UniProt: A0A1W6L5P2
LinkDB All DBs
Position
complement(1271192..1273570)
Genome map
AA seq 792 aa AA seqDB search
MSESKRATENNATSSSRPTHSRTPRWVRWVGKAVLWCAGSAVAGAFAVLLLGGVALAVAY
PHLPQISGLVDYRPKLPMRIYSADNVLLGEFGEERRNFTPIDQVPKVMKDAVLAIEDARF
YEHSGVDYKGVLRAGLAHLSDARSQGASTITMQVARNFYLSTEKTFTRKIYEVLLALKIE
TQLTKDQILEVYMNQIFLGQRAYGFAAASEIYFGKPLQQITVAEAAMLAGLPKAPSSYNP
IANPRRATIRQQYIIDRMLENGFITAEEHDAARKQPLRYRQPAEVPVHAEYVAEATRQML
YSQYGDEAYSRGLNVHLTIEAGEQSVAYRSLRKGILDYERRQHYRGPEAYIDLPADAKDI
DTRVAEALVDHPDNDELRAGVALEAGPRKVVAMLQNGETVTVTGDGLKPVTSGLSDKAGP
KTRIRPGAVIRLVKLPKGDWAVTQLPEVEGAFVALDPRTGAVRALVGGFDYAKNKFNHVT
QAWRQPGSSFKPFIYSASLEKGFTPATVINDAPLFFNAGSTGSQPWEPKNYDGTFDGPMS
MRRGLAKSKNMISIRILQSITPAYAQDWVTRFGFEADKHPAYLTMALGAGSVTPMQMASA
YGVFANGGYRLNPYLISKVTDSKGKVLTEAKPQPLDDSTRTIDARNAFVMSSLLQEVTRS
GTAARAQGTLKRPDIYGKTGTTNDALDAWFVGYQKTIVAAVWIGYDTPRKLGARETGGGL
ALPVWIDFMATTLKGVPVEEPSAPGGLVNQGGEWYYEEYTHGSGVSSLGLDDKLPAAPSE
EEKKGILDLFKN
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccaagcgcgcgaccgagaacaacgccacgtcttcctcccgtccgacccat
tctcggacgccacgctgggttcgctgggtcggaaaagcagtcctttggtgtgccggttcc
gcggttgcaggcgcgttcgccgtgctgctgctgggcggcgtggccctggcggtcgcctac
ccgcaccttccccagatcagtggcctggtggactaccgccccaagctgcccatgcgcatc
tactcggccgacaacgtcctgctgggcgagttcggcgaggagcgccgcaacttcaccccg
atcgaccaggtcccgaaggtcatgaaggacgccgtgctcgccatcgaggacgcgcgcttc
tatgaacacagcggcgtcgactacaagggcgtgctgcgggccggcctcgcccacctgagc
gacgcgcggagccagggcgcctccaccatcacgatgcaggtggcccgcaacttctacctg
tccaccgagaagacgttcacccgcaagatctacgaggtgctgctggcgctcaagatcgag
acgcagctcacgaaggaccagatcctcgaggtctacatgaaccagatcttcctgggccag
cgcgcgtacggattcgcggcggccagcgagatctacttcggcaagcccctgcagcagatc
accgtggccgaggccgcgatgctggccggcctgcccaaggcgccgtcgagctacaacccg
atcgccaacccgcgccgcgccaccatccggcagcagtacatcatcgaccgcatgctcgag
aacggcttcatcaccgccgaggagcacgacgccgcgcgcaagcagccgctgcgctaccgc
cagcccgccgaggtgccggtgcatgcggagtacgtggccgaggccacccgccagatgctg
tattcgcagtatggcgacgaggcctacagccgcggcctgaacgtccacctgaccatcgag
gcgggcgagcagagcgtcgcctaccgctcgctgcgcaagggcatcctcgactacgagcgc
cgccagcactaccgcggaccggaggcctacatcgacctgccggccgacgcgaaggacatc
gacacccgcgtcgccgaggccctggtcgaccacccggacaacgacgagctgcgcgccggc
gtcgccctggaggccggcccgcgcaaggtggtcgccatgctgcagaacggcgagaccgtg
acggtcaccggcgacggcctgaagccggtcacctcggggctgtccgacaaggccggcccg
aagacgcgcatccgccccggcgcggtgatccgcctcgtcaagctgccgaagggcgactgg
gcggtcacgcagttgcccgaggtcgagggcgccttcgtcgcactggacccgcgcacgggc
gccgtccgggcgctggtgggcggcttcgactatgcgaagaacaagttcaaccacgtgacg
caggcctggcgccagccgggttcgagcttcaagccgttcatctactcggcctcgctcgag
aagggcttcaccccggccacggtgatcaacgacgcgccgctgttcttcaacgcggggtcc
accggcagccagccgtgggagccgaagaactacgacggcacgttcgacggcccgatgtcg
atgcgccggggcctggcgaagtcgaagaacatgatctcgatccgcatcctgcagtccatc
accccggcctacgcgcaggactgggtcacgcggttcggcttcgaggccgacaagcacccc
gcctacctgaccatggcgctgggtgccgggtcggtcacgcccatgcagatggccagcgcc
tacggcgtgttcgcgaacggaggctaccgcctgaacccgtacctgatcagcaaggtgacc
gactcgaagggcaaggtgctcaccgaggcgaagccgcagccgctcgacgactccacccgc
accatcgacgcccgcaatgcgttcgtgatgtccagcctgctgcaggaagtcacccgctcc
ggcacggcggcccgcgcgcagggcacgctgaagcgccccgacatctacggcaagaccggc
accaccaacgacgcgctcgacgcgtggttcgtcggctaccagaagacgatcgtggcagcc
gtgtggatcggctacgacacaccgcgcaagctgggcgcccgcgaaacgggcggcggcctc
gcgttgccggtctggatcgacttcatggccaccacgctcaagggcgtgcccgtcgaggaa
ccctcggcgccgggcggcctcgtgaaccagggcggcgagtggtactacgaggagtacacc
cacggctcgggcgtcagcagcctcggtctcgacgacaagctgccggcagcacccagcgag
gaagagaagaagggcatcctcgacctgttcaagaactga

DBGET integrated database retrieval system