KEGG   Rhizobacter gummiphilus: A4W93_12375Help
Entry
A4W93_12375       CDS       T04831                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rgu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A4W93_12375
Enzymes [BR:rgu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A4W93_12375
Transporters [BR:rgu02000]
 Other Transporters
  Pores ion channels [TC:1]
   A4W93_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ARN20624
UniProt: A0A1W6L8T2
LinkDB All DBs
Position
2787325..2787948
Genome map
AA seq 207 aa AA seqDB search
MFKLFTAPGTCALAVHIALEEAAAKHEIAWVDLRSNAQRSPDYLKLNPKGRVPALATPEG
VLTETPALLAFIGQSFPDAHLVPASPYEFARLQSVTSYLCSTVHVAHAHRPRGIRWVEAA
DTEALEAMRRNVPRTMGECFEYIENELFAGPWLMGEQYTVADPYLFTIAGWLESDGVDPS
RFPKVLGHTLRMKERPAVARVLAQLPA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagctcttcaccgcccccggcacctgcgcgctggccgtccacatcgccctcgag
gaggccgcagcaaagcacgagatcgcctgggtggacctgagaagcaacgcccagcgttct
cccgactacctgaagctcaacccgaagggccgggtgcccgcgctcgccacgcccgagggc
gtgctgaccgagaccccggcgcttctcgccttcatcggccagtcgttcccggatgcgcac
ctcgtgcccgcgtcgccatacgagttcgcgcgcctgcagtcggtcaccagctacctgtgc
tcgacggtgcacgtggcccacgcccaccgtccccgcggcattcgctgggtggaggcggcc
gacaccgaggcgctggaggcgatgcgtcgcaacgtgccgcgcacgatgggtgaatgtttc
gagtacatcgagaacgaactgttcgccggcccgtggctgatgggcgagcagtacaccgtg
gccgacccgtacctgttcaccatcgccggctggctggagtccgatggggtcgatccgtcg
cggttcccgaaggtgctcggccacacgctgcgcatgaaggagcgcccggccgtggcgcgg
gtgctggcgcaactgcccgcgtga

DBGET integrated database retrieval system