KEGG   Rhizobacter gummiphilus: A4W93_16180Help
Entry
A4W93_16180       CDS       T04831                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
rgu  Rhizobacter gummiphilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr HDOD Kdo RIO1 APH Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-ProteinID: ARN21313
UniProt: A0A1W6LAQ0
LinkDB All DBs
Position
complement(3613049..3615460)
Genome map
AA seq 803 aa AA seqDB search
MALLAPAPVAQLGRFELRRQLGRGAQATVWLAFDPRLEREVAVKLMHVGATVNAASPWLQ
EARSVSRLNHPHIVPLFEADMHEQQAYLVFEYVAGQTLAERLKSKGPMPAREAAQLMVNV
LDALQTAHAAGVVHRDLKPSNILLDDQSRARVMDFGIAARVTDAAKQQVVGTPGYMSPEA
THGVKPSPAMDVFSAGLVLAELLSGRPVIAERDPFRAMYRVAHEDLRLPEPMGADVDDAL
RAIVQRSIARDAASRHASAAELRDALLQWLNPAAVTDAAAGSSGTLEFLLRRMRHKTDFP
ALSDSVGRIQRVANSENESLASLSGEILKDVALTNKLLRMVNTAHYSQAGGGSISTVSRA
VALIGFAGIRNMALSLVLLEHMHDKAHANQLKEEFLRSLMAGSLANELSSGGRDGEEAFI
GAMFQNLGRLLTEFYFPEEARQVRSLRAAPPRPGLPAESEDAASFKVLGLSFEELGVGVA
KAWGLPEGLQRCMRKPGAEVPSRAGDKPGERLRWIAFVSNEVTDVLLQADAGQASAAIAR
VAEKYMRVLGIGARDMQAAAALAQQRVADLARAMGLQVQPGSPMRRLLATHGNGTGSPAP
HDTITEHALHATMPADGTAPQAGTMATGEGAAEMLAAGIQDITNTMVEDFRLNEVLRMIL
ETMLRALGFQRIVFCLRDPKTETLTGRFGLGHGVENVSPIFKVALKPAPGSPPDLFSAVC
LKGADTLISDTSVGSIASRLPAWYAKSVNAPAFLLLPLLMKGAPFALIYADKSAPGGIEL
GEKELSLLRTLRNQAVMAFKQSS
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggctcttctcgcgcccgcgcccgttgcccagctgggccgcttcgagctgcgccgccag
ctcgggcgaggtgcccaggccaccgtgtggctcgcgttcgacccccgcctggagcgcgag
gtggccgtcaagctgatgcacgtgggcgccaccgtcaacgccgccagcccgtggctgcag
gaggcgcgcagcgtcagccgcctgaaccatccgcacatcgtgccgctcttcgaggcggac
atgcacgagcagcaggcctacctcgtcttcgagtacgtcgcggggcagaccctcgccgag
cggctgaagtcgaagggccccatgcccgcgcgcgaggcggcgcagttgatggtcaacgtg
ctcgacgcgctgcagaccgctcacgccgccggtgtcgtgcaccgcgacctcaagccgtcg
aacatcctgctcgacgaccagtcccgcgcccgcgtgatggacttcggcatcgccgcccgg
gtcaccgacgccgcgaagcagcaggtggtcggcacgcccggctacatgtcgccggaggcc
acgcacggcgtcaagccgtcgccggccatggacgtgttctcggccggcctcgtgctcgcc
gaactgctgtcgggccggccggtgatcgccgaacgcgacccgttccgcgcgatgtaccgc
gtggcccacgaagacctgcgcctgcccgaacccatgggcgccgacgtggacgacgcgctg
cgcgccatcgtccagcgcagcatcgcgcgcgacgcggcgagccgccacgccagcgcggcc
gagctgcgcgacgcactgctgcagtggttgaaccccgccgccgtgaccgacgcggccgcg
ggcagcagcggcacgctcgagttcctgctgcgccgcatgcggcacaagaccgacttcccc
gcgctgtccgactcggtggggcgcatccagcgcgtcgcgaactccgagaacgagagcctc
gccagcctgtccggcgagatcctgaaggacgtcgcgctcaccaacaagctgctgcgcatg
gtcaacaccgcgcactacagccaggcgggcggcggcagcatcagcacggtctcgcgcgcg
gtggccctgatcgggttcgccggcatccgcaacatggcgctgagcctcgtgctgctggag
cacatgcacgacaaggcgcacgcgaaccagctcaaggaggagttcctccgctctctgatg
gcgggttcgctcgccaacgagctgagcagcggcggccgtgacggcgaggaagcgttcatc
ggcgcgatgttccagaacctcggccgcctgctgaccgagttctacttccccgaggaagcc
cgccaggtgcgcagcctgcgcgccgcgcccccgcggccgggcctgcccgccgagtccgag
gacgcggcgtcgttcaaggtgctgggcctgagcttcgaggagctcggggtcggtgtcgcg
aaggcctggggcctgccggaaggcctgcagcgctgcatgcgcaagccgggcgccgaggtg
ccgtcgcgggcgggcgacaaacccggcgagcgcctgcgctggatcgccttcgtctcgaac
gaggtcaccgacgtgctgctgcaggccgatgccggccaggccagcgccgccatcgcccgg
gtcgccgaaaagtacatgcgcgtgctgggcatcggcgcgcgcgacatgcaggccgccgcc
gcgctcgcgcagcagcgcgtggccgacctcgcgcgggcgatgggcctgcaggtgcagccg
ggctcgcccatgcgacgcctgctcgccacgcacggcaacggcaccgggtcgccggcgcca
cacgacacgatcaccgaacacgcgctgcacgccacgatgcccgccgacggcaccgcgccg
caggccggcaccatggccacgggcgagggcgccgccgagatgctggccgccggcatccag
gacatcacgaacacgatggtggaggacttccgcctcaacgaagtgctgcgcatgatcctc
gagaccatgctgcgcgcactcggcttccagcgcatcgtcttctgcctgcgcgacccgaag
accgagacgctcacgggccgcttcggcctcgggcacggggtcgagaacgtgtcgccgatc
ttcaaggtcgcgctcaagcccgcgcccggctcgccgcccgatctcttctccgcggtgtgc
ctgaagggcgccgacaccctcatctccgacacctccgtgggctccatcgcatcgcgcctt
ccggcgtggtacgccaagtccgtcaacgcgccggccttcctgctgctgccgctgctgatg
aagggcgcgccgttcgcgctcatctacgccgacaagtccgcccccggtggcatcgagctc
ggcgagaaggaactctcgctgctgcgcaccttgcgcaaccaggccgtgatggccttcaag
cagtcgagctga

DBGET integrated database retrieval system