KEGG   Rhizobacter gummiphilus: A4W93_24780Help
Entry
A4W93_24780       CDS       T04831                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00010  Glycolysis / Gluconeogenesis
rgu00620  Pyruvate metabolism
rgu01100  Metabolic pathways
rgu01110  Biosynthesis of secondary metabolites
rgu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4W93_24780
   00620 Pyruvate metabolism
    A4W93_24780
Enzymes [BR:rgu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     A4W93_24780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ARN22867
UniProt: A0A1W6LF76
LinkDB All DBs
Position
complement(5440300..5441820)
Genome map
AA seq 506 aa AA seqDB search
MDMMEPGKFGLAVPFKKRYENYIGGQWVAPSGGQYFDNVTPVTGKVFCEVPRSTAEDIDR
ALDAAHAAKVAWGKTSPAERANVLNRIADRIEQNLPMLATAETWDNGKPIRETMAADLPL
AVDHFRYFASCVRAQEGGISEIDHQTFAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLMELIGDLLPPGVVNIVNGFGVEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMSKDDAFLDKALEGFAMFALNQGEV
CTCPSRALVQESVYEKFMEKAIARVGKIKQGNPLESDTMIGAQASNEQLEKILSYLDIGK
QEGAKCLIGGERHKMAGELEGGYYVKPTVFQGNNKMRIFQEEIFGPVVSVTTFKDEAEAL
AIANDTLYGLGAGVWSRDMNTAFRMGRGIQAGRVWTNCYHHYPAHAAFGGYKNSGIGREN
HKMMLDHYQQTKNLLVSYSDSALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatgatggaacccggcaagttcggcctcgcggtgccgttcaagaagcggtacgag
aactacatcggcgggcagtgggtcgctccgtccggtggccagtacttcgacaacgtcacg
cccgtcacgggcaaggtcttctgcgaggtgccgcgttcgacggccgaggacatcgaccgc
gcgctcgacgccgcacatgccgcgaaggtggcctggggcaagacttcgccggccgaacgc
gccaacgtgctgaaccgcatcgccgaccgcatcgagcagaacctgccgatgctggccacg
gcggagacctgggacaacggcaagcccatccgcgagacgatggcggccgacctgccgctc
gccgtcgaccacttccgctacttcgcgtcgtgcgtgcgcgcgcaggaagggggcatcagc
gagatcgaccaccagaccttcgcgtaccacttccacgagccgctgggcgtggtgggccag
atcatcccgtggaacttcccgatcctgatggcagtgtggaagctcgcgcccgcgctggcc
gccggcaactgcgtggtgctcaagcccgcggagcagacgcccgcgtccatcctcgtgctg
atggagctcatcggcgacctgttgccgccgggcgtggtcaacatcgtcaacggcttcggc
gtggaggcgggcaagccgctcgcgtcgagcaaccgcatcgcgaagatcgcgttcaccggc
gagaccaccaccggccggctgatcatgcagtacgcgagccagaacatcattcccgtgacg
ctggaactcggcggcaagtcgcccaacatcttcttcgccgacgtgatgtcgaaggacgac
gcgttcctcgacaaggccctggagggcttcgcgatgttcgcgctgaaccagggcgaggtg
tgcacctgcccgtcgcgcgcgctggtgcaggagtcggtctacgagaagttcatggaaaag
gccatcgcgcgcgtcggcaagatcaagcagggcaacccgctcgagagcgacacgatgatc
ggcgcgcaggcttcgaacgagcagctggagaagatcctcagctacctcgacatcggcaag
caggagggcgcgaagtgcctgatcggtggcgagcggcacaagatggccggtgaactggag
ggcggctactacgtgaagcccacggtgttccagggcaacaacaagatgcgcatcttccag
gaggagatcttcggtccggtggtgtcggtcaccacgttcaaggacgaggcggaggccctg
gccatcgccaacgacacgctctacggcctcggggcgggcgtgtggagccgcgacatgaac
accgcgttccgcatgggccgcggcatccaggcaggacgggtgtggacgaactgctaccac
cactacccggcacacgccgcgttcggcggctacaagaactcgggcatcggacgcgagaac
cacaagatgatgctcgaccactaccagcagacgaagaacctgctggtgagctacagcgac
agcgcgctggggttcttctga

DBGET integrated database retrieval system