KEGG   Rhodococcus jostii: RHA1_ro00056Help
Entry
RHA1_ro00056      CDS       T00382                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00030  Pentose phosphate pathway
rha00051  Fructose and mannose metabolism
rha00052  Galactose metabolism
rha00680  Methane metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01230  Biosynthesis of amino acids
Module
rha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rha_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro00056
   00030 Pentose phosphate pathway
    RHA1_ro00056
   00051 Fructose and mannose metabolism
    RHA1_ro00056
   00052 Galactose metabolism
    RHA1_ro00056
  09102 Energy metabolism
   00680 Methane metabolism
    RHA1_ro00056
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RHA1_ro00056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABG91892
UniProt: Q0SKP4
LinkDB All DBs
Position
62407..63360
Genome map
AA seq 317 aa AA seqDB search
MPDIVTLTMNPALDITTSTNRVVPTDKVRCGAPRRDPGGGGLNVARVLHVLGTPATAVFP
SGGHTGRALEDLVATEGVEIRSLTIRGSTRESLTINENETGLQYRFVLPGPTVTAREQVA
CLDLVIEVASGADYVVVSGSLPPGVPADFYQQVADVVGDLGARVIVDTSGPALRQLRGGV
FLVKPSIRELRDWTGRELSAIDDQVAAAREVIDRGVSQIVVLSLGADGALLVTRDRDEHF
PSVQVPVVSGVGAGDSMVAGVVCGLAHGRSLSDSVRYGIAAGAAMLQTPGTALCRRPDVE
RFYQLLTDGSAAGTIVG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacatcgtgacgttgacgatgaatcctgcgctcgacatcaccacgagcacgaac
cgggtggtgccgaccgacaaggtgcgctgcggcgcgcctcgccgagatcccggcggcggc
ggactgaacgtggcccgggtactgcacgttctcggaactcccgcgacggcggtgtttcct
tcgggcggccatacaggccgggccctcgaggatctcgtggccaccgagggcgtcgagatc
cggagtctgacgatccgcggttccacacgggagagcctgacgatcaacgagaacgagacg
ggtctgcagtaccgtttcgtcctgccgggaccaacagtgaccgcaagggaacaggtggcc
tgtctcgacctggtcatcgaggtcgcgtcgggcgccgactatgtggtggtgagcggaagt
ctgccaccgggtgtgcccgccgatttctaccagcaggtggcagacgtcgtcggcgacctc
ggtgcgcgagtcatcgtcgatacgtccggtccggccctgagacaacttcggggtggtgtg
tttctcgtcaaaccgagcattcgcgaactccgggactggacggggcgggagttgtcggcg
atcgacgaccaggtggcagcggctcgggaagtcatcgaccggggggtctcccagatcgtc
gtcctctcgctcggtgccgatggcgctctgctggtcacacgggaccgcgacgagcatttc
ccgtcggtccaagtcccggtggtcagcggtgtcggtgcaggcgacagcatggtcgccggt
gtggtgtgcggcctggcacacggtcgttcgttgagcgactcggtgcggtacgggatcgcc
gcgggggcggccatgctgcagacaccgggcaccgccctgtgccggcgacccgacgtcgag
cggttctatcaactgctcaccgacggatccgccgcgggcaccatcgtcggatag

DBGET integrated database retrieval system