KEGG   Rhodococcus jostii: RHA1_ro01460Help
Entry
RHA1_ro01460      CDS       T00382                                 

Definition
(GenBank) possible adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00230  Purine metabolism
rha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RHA1_ro01460
Enzymes [BR:rha01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     RHA1_ro01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc HAMP
Motif
Other DBs
NCBI-ProteinID: ABG93278
UniProt: Q0SGQ8
LinkDB All DBs
Position
1539039..1540640
Genome map
AA seq 533 aa AA seqDB search
MTMRSPRRSVAPLGSWLLGSPDESPRRRRIRVQLLLTAPLVFTNLVGAVITCLLVSVVVP
GPNVWSSEFVIANFVAVPVFVLCAVLVGVTWGTKRLVSDLRWATEDDVPTDHDRSAAFRA
PWRLTRVQAALWGIGLVFFTTLYGIIDPQTIPKVAFTIALAGITVSAFCYLLTEFALRPI
AARALGSDGPRPRRTLGITGRTALAWILGTGVPVLGLMLIAIFSFIRPASPTSLAVSILA
LGGVILLFGLLLVVISVRATEAPIRSVSLGMAKVAEGDLDAEVVVYDGTELGALQTGFNR
MAEGLRERERIRDLFGRHVGQEVASQALLRNPELGGEERDVAVLFVDIIGSTTIAATRSP
AEVVDLLNRFFNVVVDEVDRRDGFVNKFEGDAALAIFGAPVALDDHAGAALSAARALRER
LTAEVPECDAGIGVAAGRAVAGNIGAHERFEYTVIGDPVNEAARLSELAKNVSGHVVASE
RAIDAASDDERRRWQLTDTVTLRGRVEPTTLAVPAELLPAGSAVDDEGADSVE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactatgcgcagcccccgccgatccgtcgccccgctggggtcgtggttgctcggatca
ccggacgagagtccccgcaggcgccggatccgggtccagctgctgctgaccgccccgctg
gtgttcaccaacctggtcggcgcggtgatcacctgcctgctcgtcagtgtcgtcgtcccc
ggcccgaatgtgtggtcgagcgagttcgtgatcgccaacttcgttgcggtgcccgtcttc
gtgctgtgcgcggtcctggtcggcgtgacgtggggcaccaagcggctggtgtcggatctc
cggtgggcgacggaggacgacgtacccaccgaccacgaccggtcggcggcgtttcgcgca
ccgtggcgtctgacgcgtgtccaggcggcgttgtggggcatcgggctggtgttcttcacg
acgctgtacggcatcatcgatccccagaccattccgaaggtcgcgttcacgatcgcgttg
gccgggatcacggtctccgcgttctgctacctgctgacagagttcgcgctgcgccccatc
gccgcccgggcactgggctcggacgggccacgaccccgtcggaccctcggcatcaccggc
cgcaccgcgctggcgtggatcctcgggaccggtgttcccgtgctcggtctgatgctcatc
gcgatcttcagtttcatccggccggcgagtccgaccagcctcgcggtgtcgatcctcgcg
ctgggtggtgtgatcctgctcttcggcctgctgctggtcgtgatcagtgtccgcgccacc
gaggcacccatccgctcggtgtcgctgggcatggcgaaggtggcggagggcgatctggat
gccgaggtcgtcgtgtatgacggcaccgaactcggcgcgctgcagaccgggttcaaccgg
atggccgagggactccgcgaacgtgagcggatccgcgacctgttcggtcgccacgtcggg
caggaggtcgcgtcccaggctctcctccgcaaccccgaactcggcggggaggaacgtgac
gtggcggtcctgttcgtcgacatcatcgggtccaccacgatcgcggccacccggtcgccc
gcggaagtcgtggacctgctcaaccggttcttcaacgtggtcgtggacgaggtcgatcgg
cgagacgggttcgtcaacaagttcgaaggtgacgccgcgctggccatcttcggggcaccc
gtggcgctcgacgaccatgcaggcgctgcgctctccgccgctcgggccctccgcgaacgg
ctcaccgccgaggtaccggagtgcgatgcgggaatcggggtggcggcgggtcgcgccgtg
gccggaaacatcggcgcccacgaacgtttcgagtacacggtgatcggcgatccggtcaac
gaggcggcgcggttgtccgagctcgccaagaacgtgtccggacacgtcgtcgcgtccgag
cgggcgatcgacgcggcatccgacgacgagcgcaggcggtggcaactcaccgacaccgtc
accctgcgtggccgtgtcgagccgaccacgttggccgttcccgccgaactactccccgcc
ggttccgccgtcgacgatgagggcgccgactccgtcgagtag

DBGET integrated database retrieval system