KEGG   Rhodococcus jostii: RHA1_ro01472Help
Entry
RHA1_ro01472      CDS       T00382                                 

Gene name
atpD
Definition
(GenBank) H(+)-transporting two-sector ATPase beta subunit
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00190  Oxidative phosphorylation
rha01100  Metabolic pathways
Module
rha_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RHA1_ro01472 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:rha00194]
    RHA1_ro01472 (atpD)
Enzymes [BR:rha01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     RHA1_ro01472 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     RHA1_ro01472 (atpD)
Photosynthesis proteins [BR:rha00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   RHA1_ro01472 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N T3SS_ATPase_C RsgA_GTPase ATPase AAA AAA_16 AAA_19 AAA_25 RNA_helicase ATPase_2 DUF2806 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ABG93287
UniProt: Q0SGP9
LinkDB All DBs
Position
complement(1553093..1554544)
Genome map
AA seq 483 aa AA seqDB search
MTAAVTENNGAGSGSSVAGRVVRVIGPVVDVEFPRGAIPELFNALHAEITLPSVAKTLTL
EVAQHLGDNLVRTVSMQPTDGLIRGTSVSDTGKPISVPVGDVVKGHVFNALGDCLDAPGT
GRDGEQWGIHRKPPAFDQLEGKTEILETGIKVIDLLTPYVKGGKIGLFGGAGVGKTVLIQ
EMITRIAREFSGTSVFAGVGERTREGTDLHLEMEEMGVLQDTALVFGQMDEPPGTRMRVA
LSALTMAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGELQ
ERITSTRGRSITSLQAIYVPADDYTDPAPATTFAHLDATTELSRPISQMGIYPAVDPLTS
TSRILEPGIVGAEHFRVANEVKRILQKYKELQDIIAILGMDELQEEDKVLVGRARRLQKF
LGQNFIVAEKFTGEPGSVVPLRDTIEAFDRICKGEFDHLPEQAFNSCGGLDDVEAAAKKI
AGK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagcagtaaccgaaaacaacggggcaggctcgggttcgtccgtcgccggccgc
gtcgtgcgggtcatcggtcccgtcgtggacgttgaattcccgcgtggcgctattcctgaa
ctgttcaacgccctgcacgccgagatcacgctcccctcggtcgccaagacgctgaccctc
gaggtcgcacagcacctcggcgacaacctggtgcgcaccgtctcgatgcagcccaccgac
ggcctgatccgcggcacctcggtgtccgacaccggcaagccgatctcggttcccgtcgga
gacgtcgtcaagggccacgtgttcaacgcactgggcgactgcctcgacgctcccggcacg
ggtcgcgacggcgagcagtggggcatccaccgcaagccaccggccttcgaccagctcgag
ggcaagacggagatcctcgagaccggcatcaaggtcatcgacctcctcaccccgtacgtc
aagggtggaaagatcggtctgttcggtggtgccggtgtcggcaagaccgttctgatccag
gaaatgatcacccgtatcgcccgcgagttctccggaacctcggtgttcgcaggcgtcggt
gagcgcacccgtgagggcaccgaccttcacctcgagatggaagagatgggcgtcctccag
gacaccgccctcgtcttcggccagatggacgagccgccgggaacgcgtatgcgcgtcgcc
ctgtccgcgctgaccatggcggagtacttccgcgatgtccagggccaggacgtgctgctg
ttcatcgacaacatcttccgtttcacccaggccggttccgaggtgtcgaccctgctcggt
cgtatgccttcggccgtgggttaccagccgaccctggctgacgagatgggtgagctgcag
gagcgcatcacctcgacgcgaggccgctccatcacctcgctgcaggcgatctacgtgccc
gccgacgactacaccgacccggcgccggcaacgacgttcgcgcacctcgatgccaccacc
gagctgtcgcgtccgatctcgcagatgggtatctaccccgctgtggacccgctgacctcc
acctcccgcatcctggagcccggcatcgtcggtgccgagcacttccgggtcgccaacgag
gtcaagcgcatcctgcagaagtacaaggaactgcaggacatcatcgccatcctcggtatg
gacgagctgcaggaagaggacaaggtgctcgtcggccgtgcccgccgcctgcagaagttc
ctcggccagaacttcatcgtcgccgagaagttcaccggtgagcctggctccgtggtgccg
ctccgcgacaccatcgaggcgttcgaccgcatctgcaagggcgagttcgatcacctgccc
gagcaggcgttcaacagctgcggtggactcgacgacgtcgaggctgcagccaagaagatc
gccgggaagtag

DBGET integrated database retrieval system