KEGG   Rhodococcus jostii: RHA1_ro03348Help
Entry
RHA1_ro03348      CDS       T00382                                 

Definition
(GenBank) probable butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00071  Fatty acid degradation
rha00280  Valine, leucine and isoleucine degradation
rha00410  beta-Alanine metabolism
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro03348
   00650 Butanoate metabolism
    RHA1_ro03348
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro03348
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro03348
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHA1_ro03348
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     RHA1_ro03348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ABG95151
UniProt: Q0SBD5
LinkDB All DBs
Position
3538593..3539744
Genome map
AA seq 383 aa AA seqDB search
MGKLNEEEAYLVETVRAFVDRDVKPTVQAVEHANEYPEKWIEQMKQIGIYGLAVPEEYGG
SPVSMPCYAQVTQELARGWMSLAGAMGGHTVVAKLLSLYGTEEQKRQYLPQMATGEIRAT
MALTEPGGGSDLQAMSTNAKTDGDDLVISGSKTWISNARRSGLIALLCKTDPGASPKHKG
ISIVLVEHGPGLTVSRDLPKLGYKGVETCELSFDNYRISSDAVLGGTPGKGFAQMMKGLE
TGRIQVACRALGVATAALEDSLAYAQQRESFGKPIWKHQSIGNYLADMATKLTAARQLTW
HAAEQYDSGDRCDMEAGMAKLYASEVAMDIALNAVRIHGGYGYSTEYDVERYFRDAPLMI
VGEGTNEIQRNVIVSQLVSRGGL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagctgaacgaggaagaggcgtacctggtcgagacggtgcgcgccttcgtcgac
cgcgacgtgaagccgacggtgcaggcggtggagcacgccaacgagtaccccgagaagtgg
atcgagcagatgaagcagatcgggatctacggtctggcggtcccggaggagtacggcgga
tcaccggtgtcgatgccctgttatgcgcaggtgacccaggaactggcccgcgggtggatg
agcctggccggggcgatgggtgggcacaccgtcgtggcgaagctgctgtcgctgtacggc
accgaggagcagaagcggcagtatctgccgcagatggcgaccggcgagatccgggccacg
atggcgctgaccgagcccggcggcgggtcggatctgcaggcgatgtccaccaacgccaag
accgacggcgacgatctggtgatctccggttcgaagacgtggatctccaacgcccgccgg
tccgggctgatcgcgctgctgtgcaagaccgacccgggcgcgtcccccaagcacaagggc
atttcgatcgtcctggtcgagcacggtcccggcctgacggtgtcgcgggatctgcccaag
ctcggctacaagggcgtcgaaacctgtgagctgtcgttcgacaactaccggatctcgtcg
gacgcggtcctgggtggcaccccgggcaaggggttcgcgcagatgatgaagggcctcgag
accggccgcatccaggtggcctgccgggccctgggtgtggcgacggcggcgctcgaggac
tctttggcgtatgcgcagcagcgggagagcttcggcaagccgatctggaagcatcagtcg
atcggcaactacctggcggacatggcgaccaagctgaccgcggcccggcagctgacctgg
cacgcggccgagcagtacgacagcggtgatcggtgcgatatggaggccgggatggcgaag
ctgtacgcgtccgaggtggcgatggacatcgccctgaacgcggtgcgcatccacggcggc
tacggctattccaccgagtacgacgtcgagcggtacttccgggacgccccgttgatgatc
gtcggcgagggcaccaacgagatccaacgcaacgtcatcgtctcgcaactcgtatcgcgc
ggagggctctga

DBGET integrated database retrieval system