KEGG   Rhodococcus jostii: RHA1_ro05107Help
Entry
RHA1_ro05107      CDS       T00382                                 

Definition
(GenBank) possible DNA ligase (ATP), C-terminal
Organism
rha  Rhodococcus jostii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABG96888
UniProt: Q0S6E8
LinkDB All DBs
Position
5443353..5444396
Genome map
AA seq 347 aa AA seqDB search
MDLPVMPPLQPMLAKAASSVPAQPESGLAWSYEPKWDGFRTLVFRDGDEVVLGSRGGKDL
ARYFPELVRAVKDELPQRCVVDGELVVPRNIDGRTRLDWESLSERIHPAESRVTMLSEKT
PAQFVAFDLLALGDRDLSREDFSVRRAQLVDTIGGGPSCHVTAATESSATATEWFEAFEG
AGLDGVVAKKLVGPYLPNKREMVKVKHARTADCVVIGYRPHKSQPGIGSMLLGLYDGDQM
AMVGGASAFTAARRIELLAELDELRVGDDVVADGAPTRWQSGNDRTWVPLRPERVVEVAY
DQMEGARFRHAARFLRWRPDRTPDECTFQQLEVPVRYDLADVLAGGS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggatctccccgtgatgcctccgttacagccgatgctcgcgaaggctgcgtcgtccgtt
ccggcgcaaccggagtccggcctcgcctggtcctacgaaccgaaatgggacggtttccgc
accctcgtcttccgcgacggcgacgaggtggtgctcgggtcccgcggcggaaaggatctg
gcgaggtactttcccgaactcgtccgggcagtgaaggacgaactgccgcagcggtgcgtg
gtggacggcgaactcgtcgtcccgcgcaacatcgacggccgcacccggctcgactgggag
tcgttgtcggagcgcattcatccggccgagagccgggtgacgatgctgtccgagaagacc
ccggcgcagttcgtcgcgttcgatctgctcgccctgggcgaccgcgacctcagccgggag
gacttctccgtacgccgcgcgcagctcgtcgacaccatcggcggcggacccagctgccac
gtcaccgccgccaccgaatccagtgcgacggccaccgagtggttcgaggcgttcgagggt
gccggcctcgacggggtggtggcgaagaagctggtgggcccgtacctgcccaacaagcgg
gaaatggtgaaggtgaagcacgcccgcaccgccgactgcgtcgtcatcggataccggccg
cacaagagtcagccggggatcgggtcgatgctgctcggactgtacgacggcgaccagatg
gcgatggtcggcggtgcgtcggcgttcacggccgcgcggcggatcgaactgctcgccgaa
ctcgacgagctgcgcgtcggcgacgacgtggtcgcggacggcgcgccgacgcggtggcag
tcgggcaacgaccgaacctgggtgccgctgcgccccgaacgcgtcgtcgaggtggcgtac
gaccagatggagggtgcccggttccggcacgccgcgcggttcctgcgctggcgcccggac
cggacgcccgacgagtgcacgttccaacaattggaggtcccggtgcgatacgaccttgcc
gacgtcctggccggaggttcctag

DBGET integrated database retrieval system