KEGG   Rhodococcus jostii: RHA1_ro05182Help
Entry
RHA1_ro05182      CDS       T00382                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
rha  Rhodococcus jostii
Pathway
rha00260  Glycine, serine and threonine metabolism
rha01100  Metabolic pathways
Module
rha_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro05182
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     RHA1_ro05182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABG96963
UniProt: Q0S673
LinkDB All DBs
Position
complement(5522759..5524207)
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLYIGGKWVAPATDQVLEVFSPATEERVGSCPVASPADIDDAVATARRAFDEGPW
PQTTPAERGEILAKAAKLIEERGDALNALISSEMGQPPAMVGMMQQTPSLATLNFYAGLA
NEFEWEQTRTGAFGQTKVLREPVGVVAAVLAWNVPLFLAVNKLSPALLAGCTVLLKPAPE
SPLSTHLLAEIFAEAGVPEGVISVLPGGAETGEYLVSHPGIDKITFTGSSPVGRKIGAIA
AQNLKRCSLELGGKSAAIILEDADLAATMPMLVMSGLMNTGQACVAQTRILAPRSRYDEV
LDALVAGAGFMTVGDPSDPAAQLGPLISEKQRDRVEGYIAKGKEQGARVVLGGGRPEGLD
KGWYVEPTIFADVDNSMTIAREEIFGPVLSVIPYDSEDEAIKIANDSDYGLAGSVYTTDI
DHGLAVAKQIRTGTYAINWYAFDPGSPFGGYKASGIGRENGPEGLEAFCETKSVLMPPGY
TG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgacaagctgtacatcggcggcaagtgggtggccccggccaccgatcag
gtgctcgaagtgttctccccggcaaccgaggaacgcgtcggcagctgtcccgtcgcgtcg
ccggccgacatcgacgacgccgtcgccacggccaggcgcgcattcgacgaaggcccgtgg
ccgcagaccactcctgccgagcgcggcgagatcctcgcgaaggcggcgaaactcatcgag
gagcgcggcgacgccctcaacgcgctgatctcgtccgagatgggtcagccgcccgcgatg
gtcgggatgatgcagcagacaccgtcgctcgcgaccctcaacttctacgccggtctcgca
aacgagttcgagtgggagcagacccgcaccggcgcgttcggacagaccaaggtgctgcgg
gaacccgtcggcgtcgtggccgcggtcctcgcctggaacgtgccactgtttctcgccgtc
aacaagctgtccccggcgctgctcgccggctgcaccgtcctgctcaagccggcacccgaa
tccccgctctccacacaccttctcgccgagatcttcgccgaggcgggggtccccgagggt
gtcatctccgtcctgcccggcggcgccgagaccggcgaatacctggtgtcgcatcccggc
atcgacaagatcacgttcaccggcagcagtcccgtcggccgcaagatcggcgccatcgcc
gcacagaacctcaagcgctgttccctcgaactgggcggcaagtcggcggccatcatcctc
gaggacgccgacctcgcggccacgatgccgatgctggtgatgtccgggctcatgaacacc
gggcaggcatgcgtcgcgcagacccggatcctcgccccgcgctcccgttacgacgaggtg
ctggacgccctggtggcgggtgccggattcatgaccgtcggagatccgtccgaccccgcc
gcgcaactcggacccctgatctccgagaagcagcgcgaccgcgtcgagggctacatcgcc
aagggcaaggaacagggcgcccgcgtggtgctcggcggcggccgtccggaaggcctcgac
aagggctggtacgtcgagccgacgatcttcgcggacgtcgacaactcgatgacgatcgcc
cgcgaggagatcttcggacccgtcctgtccgtgatcccctacgactccgaggacgaggcg
atcaagatcgccaacgactccgactacggactcgccggctcggtgtacaccaccgacatc
gatcacggtctcgccgtcgcgaagcagatccgcaccggcacctacgccatcaattggtac
gcattcgaccccggctcaccgttcggcggctacaaggcctccggcatcggtcgtgagaac
ggaccggaagggctcgaagcgttctgcgagaccaagtccgtcctcatgccgcccggctac
acggggtag

DBGET integrated database retrieval system