KEGG   Rhodococcus jostii: RHA1_ro06238Help
Entry
RHA1_ro06238      CDS       T00382                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP+)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rha  Rhodococcus jostii
Pathway
rha00020  Citrate cycle (TCA cycle)
rha00480  Glutathione metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01210  2-Oxocarboxylic acid metabolism
rha01230  Biosynthesis of amino acids
Module
rha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rha_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro06238
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RHA1_ro06238
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RHA1_ro06238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABG98015
UniProt: Q0S371
LinkDB All DBs
Position
6724697..6725920
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDETDDQVTIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVPGPGKVMITYTPEDGSEPIEHELVNFPEGGGVVQ
GQYNFTKSIEDFARASLNYGLQQNYPVYLSTKNTILKAYDGAFKDIFQHVYETEFKSEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPDVIGFAQKLE
DVVIKTVEGGQMTKDLAMLVGGDQGYLTTEEFLGALDINLQKAIAEQ
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaggttgagggcaccgtcgtcgaactcgacggcgacgagatgacgcgc
attatctggcagttcatcaaagacaaactgatccatccttacctggatgtgaatctcgag
tactacgacctcggcatcgaataccgggacgagaccgacgaccaggtgaccatcgacgcg
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcaccccggacgag
gcacgcgtcgaggagttcggtctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggtgggacgatcttccgcgcgccgatcatcatctccaacgttccgcgactg
gttccgggctggaccaagccgatcatcatcggccgtcacgccttcggcgaccagtaccgc
gccaccgacttcaaggtccccggccccggcaaggtgatgatcacctacacgcccgaggac
ggcagcgagccgatcgagcacgagctggtgaacttccccgagggtggcggcgtcgtccag
gggcagtacaacttcaccaagtccatcgaggacttcgcgcgtgcctcgctcaactacggc
ctgcagcagaactacccggtgtacctgtcgaccaagaacaccatcctcaaggcgtacgac
ggcgcgttcaaggacatcttccagcacgtctacgagaccgagttcaagtcggagttcgac
gcggcaggactcacctacgagcaccgactcatcgacgacatggtcgcgtcggcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtcggacacc
gtcgcgcagggcttcgggtcgctcggcctcatgacctccgtgctgctgaccccggacgga
aagacgtgtgaggccgaggccgcacacggcaccgtgacgcgtcacttccgtcagcaccag
cagggcaagccgacgtccaccaaccccatcgcgtcgatcttcgcatggacccgtggactc
gagcaccgcggcaagctggacaacacccccgacgtcatcggcttcgcccagaagctcgaa
gacgtggtcatcaagaccgtcgagggtggccagatgaccaaggacctcgcgatgctggtc
ggcggcgaccagggctacctgaccaccgaggagttcctcggtgcgctggacatcaacctc
cagaaggccatcgccgagcagtag

DBGET integrated database retrieval system