KEGG   Rhodococcus jostii: RHA1_ro06245Help
Entry
RHA1_ro06245      CDS       T00382                                 

Gene name
sdhB2
Definition
(GenBank) succinate dehydrogenase Fe-S protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rha  Rhodococcus jostii
Pathway
rha00020  Citrate cycle (TCA cycle)
rha00190  Oxidative phosphorylation
rha00650  Butanoate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro06245 (sdhB2)
   00650 Butanoate metabolism
    RHA1_ro06245 (sdhB2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RHA1_ro06245 (sdhB2)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RHA1_ro06245 (sdhB2)
    1.3.5.4  fumarate reductase (quinol)
     RHA1_ro06245 (sdhB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_16 Fer4_7 Fer4_4 Fer4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: ABG98022
UniProt: Q0S364
LinkDB All DBs
Position
complement(6732868..6733647)
Genome map
AA seq 259 aa AA seqDB search
MSAPAVDKSENKSDLPPVPEGAVMVTLKIARMNPESGEGQHWDSFQVPALPTDRMLNLLL
YVKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKLLMKDMLPKDGKPVTITVEPIKG
LPVEKDLVVDMEPFFDAFRAVKPFLITTGNEPTRERIQSQHDRARFDDTTKCILCACCTT
SCPVYWSDGSYFGPAAIVNAHRFIFDSRDEGASERLDILNDKDGVWRCRTTFNCTDACPR
GIQVTKAIQEVKRALLFAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacctgcagtcgacaagagcgagaacaagtcggatctccctcccgtgcccgag
ggcgccgtcatggtcaccctcaagatcgctcggatgaacccggagtccggcgagggccag
cactgggacagcttccaggttccggctctgccgacggaccgcatgctgaacctgctcctg
tacgtgaagggctacctcgacggcaccctgacgttccgtcgcagttgcgcccacggcgtg
tgtggttcggacgcgatgcggatcaacggcgtcaaccgtctggcctgcaagctcctcatg
aaggacatgctgcccaaggacggcaagccggtcacgatcaccgtcgagcccatcaagggc
ctgccggtggagaaggacctagtcgtcgacatggagcccttcttcgacgcgttccgcgcc
gtgaagccgttcctcatcaccaccggcaacgagcccacccgtgagcgcatccagtcgcag
cacgaccgggcacgtttcgacgacaccaccaagtgcatcctgtgtgcctgctgcaccacg
tcgtgcccggtgtactggagcgacggcagctacttcggtcccgctgccatcgtcaacgct
caccggttcatcttcgacagccgtgacgagggtgcgtcggagcgtctcgacatcctcaac
gacaaggacggcgtctggcgttgccggaccacgttcaactgcaccgacgcgtgcccgcgt
ggcatccaggtgacgaaggcgatccaggaagtcaagcgcgcgctgctcttcgcacgctga

DBGET integrated database retrieval system