KEGG   Rhodococcus jostii: RHA1_ro06265Help
Entry
RHA1_ro06265      CDS       T00382                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rha  Rhodococcus jostii
Pathway
rha00564  Glycerophospholipid metabolism
rha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RHA1_ro06265 (glpA)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RHA1_ro06265 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 AlaDh_PNT_C 3HCDH_N Pyr_redox Thi4 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABG98042
UniProt: Q0S344
LinkDB All DBs
Position
6754682..6756424
Genome map
AA seq 580 aa AA seqDB search
MSSQPGVQFLGPRQRDAAWDKLQTEQFDVVVIGGGVVGAGAALDAATRGLKVALVEARDY
ASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELSLTTLAPHLVKPLKFLFPITHRVW
ERPYMAAGIFLYDRMGGAKSVPAQKHLTRAGALRMAPGLKRNSLTGGIQYYDTVVDDARH
TMTVARTAAHYGAVVRTSTQVVGFLREADRVSGVRVRDCEDGRTADVKAHVVINATGVWT
DEIQALSRQRGRFRVRASKGVHIVVPRDRIVSDAAIILRTEKSVLFVIPWGSHWIIGTTD
TDWNLDLAHPAATKADIDYILGHVNKVLVTSLTHDDIDGVYAGLRPLLAGESDETSKLSR
EHAVARVAPGLVAIAGGKYTTYRVMAEDAVDLAADDIPARMAPSITEKVPLVGADGYFAL
VNQTVHLGEMYGLHPYRVKHLLDRYGSLIDEVLDQARGKPELLQPLTDAPAYLQVEVVYA
AAAEGALHLDDILARRTRIAIEYSHRGVNCAEQVAQLVAPVLGWDADAVDREVKTYQARV
EAEVQSQAQPDDLSADALRAAAPESRVELLEPPVSVSEIP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagtcagccaggtgtgcagttcctcggtccccggcagcgtgatgccgcatgggac
aagctgcagaccgaacagttcgacgtcgtcgtgatcggcggtggtgtggtcggagccggt
gcggccctcgacgcggccacccgcgggctgaaggtggcgttggtggaggcacgcgactac
gcgtccgggacgtcgagtcgctcgtcgaagatgttccacggcggtctgcgctatctcgag
cagctcgagttcgggctggtccgggaggcgctccgggagcgtgagctctcgctgacgacc
ctcgcaccgcacctggtgaagccgctcaagttcctgttcccgatcacccaccgcgtgtgg
gagcgcccctacatggcggcgggcatcttcctctacgaccggatgggcggggccaaatcg
gttccggcgcagaagcatctgacgcgggcgggtgcgctgcggatggcgccggggctcaag
cgcaactcgctgaccggcggcatccagtactacgacaccgtggtcgacgacgcccgccac
accatgaccgtcgcccgcaccgccgctcactacggggcggtcgtgcgcacgtccacgcag
gtggtcggattcctccgggaggcggaccgggtctccggagtgcgcgtccgggactgcgag
gacggccgcacggcggacgtgaaggcgcacgtcgtcatcaacgccaccggggtgtggacc
gacgagatccaggcgttgtcgcggcaacgcggccggttccgcgtccgcgcgtcgaagggc
gtccacatcgtggtgccgcgcgatcggatcgtgagcgacgccgcgatcatcctccgcacc
gagaagtcggtgctgttcgtgatcccgtggggcagccactggatcatcggcaccactgac
acggactggaatctcgacctcgcgcacccggcggccaccaaggccgacatcgactacatc
ctcggtcacgtcaacaaggtgctggtgacgtcgctgactcacgacgacatcgacggcgtc
tacgcgggtctgcgcccactgctcgcgggggagagcgacgaaacgtcgaaactctcgcgg
gaacacgccgtcgcgcgcgtggcgccgggtctggtcgccatcgcgggcggcaagtacacc
acctaccgggtgatggccgaggacgccgtggatctcgccgccgacgacattcccgcgcgg
atggcaccgtccatcacggagaaggtgccgctcgtcggtgcggacggctatttcgcgctc
gtcaatcagaccgtccatctcggagagatgtacggcctgcacccgtaccgcgtgaagcat
ctgctggaccgatacggttcgctgatcgacgaggtgctcgaccaggcgcgcgggaaaccg
gaacttctccagcccctcacggacgcgcccgcctacctgcaggtcgaggtcgtgtacgcg
gcggcggccgagggtgccctgcatctcgacgacatcctcgcccggcgcacgcgcatcgcc
atcgagtactcgcatcggggtgtgaactgcgccgagcaggtggcgcaactggtggccccg
gtcctcggctgggatgccgacgccgtcgaccgcgaggtgaagacgtatcaggcgcgggtg
gaggcggaggtgcagtcgcaggcacagccggacgacctgtcggccgacgcgttgcgggct
gcggcgcccgagtcgcgggtcgaactgctcgaaccaccggtcagtgtgtcagaaatacct
tga

DBGET integrated database retrieval system