KEGG   Rhodococcus jostii: RHA1_ro08620Help
Entry
RHA1_ro08620      CDS       T00382                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rha  Rhodococcus jostii
Pathway
rha00250  Alanine, aspartate and glutamate metabolism
rha00410  beta-Alanine metabolism
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
Module
rha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro08620
   00650 Butanoate metabolism
    RHA1_ro08620
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RHA1_ro08620
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHA1_ro08620
Enzymes [BR:rha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RHA1_ro08620
Amino acid related enzymes [BR:rha01007]
 Aminotransferase (transaminase)
  Class III
   RHA1_ro08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABG99664
UniProt: Q0RYH2
LinkDB All DBs
Position
pRHL1:complement(598400..599716)
Genome map
AA seq 438 aa AA seqDB search
MNDVSLHQRHRAVMPDWLSTYYEDNPLELVSGSGRHVTGGDGRTYLDFFGGLLATMIGHD
IPEITEALRRQAGQLLHSSTLYLIRSQVELAEKIAARAPVDNPRVFFVNSGSEAVETALL
LTTTAQQSNQVIALRGSYHGRSFGTVATTGIRGWSATSLSPLQVTYAHSGYKYRSPFGHL
DDHAFNTACRDELQTMIETSTSGNIACYLAEPIQGAGGFATPPDGFFLAMKEVLDAYDIP
FVSDEVQSGWGRTGRSYFGIEHYGVRPEAITFAKGLANGLSIGGVVAENELMNCLTANSI
STAGGNPIAMAAGNAVLDFIESHDLQANAADVGHLLSTGLQELATRHPLIGDVRGAGLML
GVELVENGTKKPAVAATNTILTQCRERGLLIGKGGLSGNVLRVTPPMTVTIEEAKQALGI
LDDVLSYVASRAEPQPIH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacgtatcactccaccagcgacaccgcgccgtgatgcccgactggctgtcgacc
tactacgaggacaaccccctcgagctggtctcgggttccggtcgccacgtcacaggagga
gacggccgaacatacctcgacttcttcggcggactcctcgcaacaatgatcgggcacgac
atacccgaaatcaccgaagccctgcgccgccaggcagggcagctactgcactcaagcacc
ctgtacctgatccgctcacaagtcgagctcgccgagaaaatcgcggcccgcgcacccgtc
gacaatccccgcgtcttcttcgtcaactcaggctcggaggcagtggaaacggcactgctc
ctgacaaccactgcccagcagtcgaatcaagtgatcgctctcagaggcagctaccacggc
agatccttcggaaccgtcgccaccacgggaatccgcggctggtccgcaacctcactgagc
cccctgcaggtcacctacgctcacagcggatacaaataccgcagcccattcgggcacctc
gacgaccacgccttcaacaccgcatgccgcgacgaactgcagaccatgatcgagacctcc
acctccggcaacatcgcctgctatctcgccgaacctatccaaggcgcgggcggattcgcg
accccacccgacgggttcttcctcgcgatgaaagaggttctcgacgcctacgacatcccc
ttcgtctccgacgaggtccaatccggatggggccgaaccggacgctcctacttcggaatc
gaacactacggagttcgccccgaagcgatcaccttcgccaaggggctcgcgaacgggctc
agcatcggcggtgtcgtcgccgaaaacgaactgatgaactgcctcaccgcgaactcgatc
tcgaccgccggcggcaacccgatcgcgatggcggcgggaaacgccgtacttgacttcatc
gagtcgcacgacctgcaagccaatgccgccgacgtcggccacctactgtcaaccgggctg
caggaactcgcgacccgccacccgctgataggagacgtgagaggcgccggactcatgctc
ggagtcgaactcgtcgaaaacggaaccaagaaacccgcagttgccgcaacgaacaccatt
ctcacgcaatgccgcgaacggggactgctcatcggcaagggcggattgtccggcaacgtc
ctccgcgtgacaccaccgatgaccgtcacgatcgaggaagccaaacaggctctcggaatc
cttgacgacgtcctctcatacgtagcatcgcgggccgagccgcaaccaatccactga

DBGET integrated database retrieval system