KEGG   Rhodococcus jostii: RHA1_ro08827Help
Entry
RHA1_ro08827      CDS       T00382                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rha  Rhodococcus jostii
Pathway
rha00020  Citrate cycle (TCA cycle)
rha00190  Oxidative phosphorylation
rha00650  Butanoate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro08827
   00650 Butanoate metabolism
    RHA1_ro08827
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RHA1_ro08827
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RHA1_ro08827
    1.3.5.4  fumarate reductase (quinol)
     RHA1_ro08827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO Trp_halogenase HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABG99871
UniProt: Q0RXW5
LinkDB All DBs
Position
pRHL1:complement(795255..796991)
Genome map
AA seq 578 aa AA seqDB search
MRTPAYEEVFTDVAIIGSGGAGLMAVLHVHDADPDLDITVISKGAVGRSGCTRMVQGGYN
AVLSPLDSIENHFVDTLDGGKYLNDQDLAWTLVNDAPKVIRELETRVGCFFDRAADGSIK
QKAFAGQSFDRTVHRGDLTGIEIMARLRDQMFRVKPRELEDVRALDLLLAADGSAAGVTC
LDVRRGRFIVVRARVVIVATGGAATMYRIAAPAREKTGDGVAMCMRAGLELRDMEMMQFH
PTGLLAGQARMTGAVLEEGLRGAGAHLYNALGERYMSKYDPERMERSTRDVVSRSSYMEI
MAGRGTATNGVLIDISHLGAAEVERRFPGMVARTRQIGSDLATGPVEVSPTAHFHMGGVV
IDSDCRTSVPGLLVAGEDAGGVHGANRLGGNGVAESTVFGCRAGDTAAVVARERRHGDLD
PAAVERSLMLAAAPLDRPGGILPFDLTRRLKDLMWERCGVVRDREGLEEAAKEIDALHED
VADVSVPGPVAFNPAWQEALDLRNQVVVARAIVQSALLREETRGAHARADFPERRDDEWL
RYLVVRQGEDGDLTIQSRPVELSRRAPEQTSQPEAKIR
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagaacacccgcgtacgaggaggtcttcaccgacgtcgccatcatcgggagcggaggt
gcggggctgatggccgtcctgcatgtgcacgacgccgacccggatctcgacatcaccgtc
atcagcaagggtgcggtcgggaggtccgggtgtactcgcatggtgcagggcggctacaac
gccgtactgagcccgctcgactccatcgagaaccattttgtggacacgctcgacggcggc
aagtatctcaacgaccaggatctcgcctggaccctcgtcaacgacgcacccaaggtgatc
cgagaactcgagacccgcgtcggttgcttcttcgaccgtgctgccgacggcagcatcaag
cagaaggccttcgcaggtcagtcattcgaccgcaccgttcaccgaggcgacctgaccggc
atcgagatcatggcccgcctgcgtgaccagatgttccgcgtcaagccacgtgaactcgag
gacgtgagggcactggacctgctcctcgccgccgacggctccgccgccggcgtgacgtgc
ctggacgtgaggcggggccggttcatcgtcgtgcgcgcgcgggtcgtcatcgtggcaacg
ggcggcgcggccaccatgtaccgcatcgccgcacccgctcgcgagaagaccggcgacggc
gtggccatgtgcatgcgagcggggcttgagctacgcgacatggagatgatgcagttccat
cccacgggtctgctcgccggtcaggcacgaatgacgggtgcagtactggaagagggcctg
cgcggcgccggtgcccatttgtacaacgccttgggcgagcgctacatgtccaagtacgac
cccgagcgcatggagcggtccacgcgcgacgtcgtctcccgctcgagctacatggagatc
atggcgggccgcgggacggccaccaacggcgtgctgatcgacatctcgcacctgggtgcc
gccgaggtggagagacggttccccgggatggtggcgagaacgcggcagatcggcagcgac
ctggcgactgggccagtcgaggtctcccccactgcccatttccacatggggggagtcgtt
atcgacagcgactgccgtacctccgtcccgggcctactggtcgcaggagaggacgccggc
ggagtgcatggagcgaatcgtctgggcggcaacggagttgccgagtccacggtcttcgga
tgccgtgcaggtgacaccgccgccgtcgtggcgcgcgagcgcagacacggcgacctcgat
cccgcagccgtggagaggtcgctcatgctggccgccgcgcccctcgaccggccgggtggg
atacttcccttcgacctgacccgccgcttgaaggacctcatgtgggagcgctgcggcgtg
gtccgcgacagggaaggacttgaggaagccgccaaggagatcgacgcgctgcacgaggat
gtggccgacgtcagcgttccggggcccgtggcgttcaacccagcatggcaggaggcgctc
gacctccggaaccaagtcgtcgtcgcccgtgccatcgtccagagcgctctactgcgtgag
gagacacgcggcgcacacgcccgagccgactttcccgagcgccgcgacgacgagtggctc
aggtacctcgttgtccgccagggcgaggacggcgacctcacgatccagtcacgtccggtg
gaactctcgcgccgagccccagaacaaacatcacagccggaggcgaagatccggtga

DBGET integrated database retrieval system