KEGG   Rhodococcus sp. B7740: NY08_1484Help
Entry
NY08_1484         CDS       T03776                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00473  D-Alanine metabolism
rhb00550  Peptidoglycan biosynthesis
rhb01100  Metabolic pathways
rhb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NY08_1484
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NY08_1484
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NY08_1484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhb01011]
    NY08_1484
Enzymes [BR:rhb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NY08_1484
Peptidoglycan biosynthesis and degradation proteins [BR:rhb01011]
 Precursor biosynthesis
  Amino acid ligase
   NY08_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: AJW39514
UniProt: A0A0D5A8Y5
LinkDB All DBs
Position
complement(1559957..1561132)
Genome map
AA seq 391 aa AA seqDB search
MIAVSRRTGRIRVRRAAAVRFLIVSTPRIKVAVVFGGRSSEHAVSCVSAGSVLQNLDPAR
YEVVPVGITPDGAWVLGSSDIDALTIHDRVLPTVDKTGAALALSTDPGHAGALLALGEGE
GGTVLASVDVVFPVLHGPYGEDGTLQGLLELAGVPYVGPGVLASAAGMDKEFTKKLLGAE
GLPIGRQVVLRRGVDDLTAGERDRIGLPAFVKPARGGSSIGISRITAWDQLPTAIAVARE
HDPKVIVEGMIHGREVECGVLEFPDGTVRASAIAEIRIPDADIDDHAFYDFDTKYLDDVS
EFDIPAALDDATSDRIRELAVAAFRALDCQGLARVDFFVTENGPVINEINTMPGFTSISM
YPKMWAESGVDYPTLIATLIDTALARGTGLR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcggtctcgcgacgaacagggcgaatccgcgttcgacgagccgcggcggtacgg
tttctcatcgtgagtactccccgcatcaaagttgccgtcgtcttcgggggccgcagcagc
gagcacgctgtgtcctgtgtatcggcaggtagcgtgctgcagaacctcgatccggccagg
tacgaggtggttccggtgggaatcaccccggacggtgcgtgggtactcggctcttccgac
atcgacgcgctgacgattcacgaccgcgtcctgcccaccgtggacaagaccggggcagcg
ctcgctctcagtacggacccgggtcacgccggcgctctgctcgccctcggcgagggggaa
ggcgggacggtgctcgcatccgtcgacgtcgtgttcccggttctgcacggaccgtacggc
gaggacggcaccctgcagggtctgctcgagttggcaggcgttccgtatgtcgggccgggc
gtgctggccagcgctgcggggatggacaaggaattcaccaagaagctgctcggtgccgaa
ggattgccgataggtcgccaggtggtactccgacgcggggtcgacgacctgacggcaggc
gagcgtgaccgaatcggcctgcccgcattcgtcaagccggcccgaggcggatcgtccatc
ggaatctcgcgcatcaccgcgtgggaccaactccccaccgcgatcgccgtcgcacgcgaa
cacgaccccaaggtcatcgtcgaaggcatgatccacggccgcgaggtcgagtgcggagtg
ctcgaatttcccgacggcaccgtgcgcgcgagcgccatcgccgagatccgaattcccgac
gcggacatcgacgatcatgccttctacgatttcgacaccaagtatctcgacgatgtcagt
gagttcgacatcccggctgccctcgacgacgccacgagcgaccgcattcgtgagctcgcc
gtcgccgccttccgcgcgttggactgccagggtctggcgcgggtggatttcttcgtcacc
gagaacggcccggtcatcaacgagatcaacaccatgcccgggttcacctcgatctcgatg
taccccaagatgtgggccgaatcgggcgtcgactacccgacgcttatcgccaccctgatc
gacaccgctctcgcccgcggtaccggtttgcgttag

DBGET integrated database retrieval system