KEGG   Rhodococcus sp. B7740: NY08_1851Help
Entry
NY08_1851         CDS       T03776                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00473  D-Alanine metabolism
rhb01100  Metabolic pathways
rhb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NY08_1851
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NY08_1851
Enzymes [BR:rhb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NY08_1851
Peptidoglycan biosynthesis and degradation proteins [BR:rhb01011]
 Precursor biosynthesis
  Racemase
   NY08_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJW39881
UniProt: A0A0D5AAM6
LinkDB All DBs
Position
complement(1921447..1922631)
Genome map
AA seq 394 aa AA seqDB search
MSIGCGDEETDPRTGSGAVATVDLDAVAHNVRVLQQFAGDAAVMAVVKADGYNHGAVEVA
RAAVAAGAQELGVTTIGEALELRAAGVTVPVLAWLHRTDSDFAAAIAGQVGIGVSTAAQL
DAVVDAARRVGSTADLSLKIDTGLNRNGVAEPDLDAVLDATAVAVAEGAVRLTGMFSHLA
CSDEPAHPANDAQAERLRDAVRRATRRGTPPAVVHLSNSAAALTRPDLGFDMVRPGIALY
GLSPVPELGTFELHPVMTLTAEVANIKKVSEGESVSYGYTWTAPADTVVALVALGYADGV
VRRLSGRFEVTIAGRRYPSVGRVCMDQFVVDLGGSDSGVAVGDEALLFGPGDRGEAHAQD
WADALETISYEVVTGVRGRVRRRFVGARSGEATI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatcggttgtggcgacgaggagaccgatcctcggacgggttcgggtgccgtcgcg
accgtcgacctcgacgcagttgcgcacaacgtccgcgtgttgcagcagttcgccggggac
gccgcagtgatggcggtcgtcaaggccgacggatacaaccacggtgccgtcgaggtagca
cgcgccgcggtcgccgcgggggcgcaggagctcggcgtcaccaccatcggtgaggccctc
gagctccgtgccgcgggtgtgaccgtcccggtgttggcgtggctgcaccgaacggactcc
gatttcgcggcggcgatagccgggcaggtcgggatcggggtatccacggctgcccagctc
gacgctgtggtcgacgctgcacgcagggtcggttccaccgctgatctctcgctcaagatc
gataccgggctcaatcgcaacggggtcgcggaaccggatctcgacgccgttctcgacgct
actgccgtcgcggtcgcggagggcgctgtgcgattgaccggaatgttctcgcatctggcc
tgctccgacgaaccggctcaccccgccaacgacgcccaggccgagcggcttcgcgacgcg
gtgcggcgcgccacccggcgcggaacccctcccgccgtcgtgcacctgtccaactcggca
gcggcgctgaccagacccgatctcggtttcgacatggtccgcccgggtattgctctgtac
ggcctgtccccggtgcccgaactgggaacgttcgaattgcacccggtcatgactctcacg
gcggaggtggcgaacatcaagaaggtgagcgaaggtgaatctgtgtcctacggctacacc
tggaccgctcccgccgacaccgtggtcgccctcgtcgctctcggatacgccgacggggtc
gtccgtcgcctcagcgggcggttcgaggtgaccatcgcaggtcgtcgctatccctccgtc
gggcgcgtgtgcatggatcagttcgtcgtcgacctcggcggcagtgactcgggtgtcgca
gtcggcgacgaggcgttactgttcggaccaggggacaggggagaggcgcacgcccaggat
tgggcagacgcgctcgagaccatcagctacgaagtcgtgaccggcgttcgtggacgtgtt
cggcgacggttcgtcggcgctcgctcaggggaggcgacgatctag

DBGET integrated database retrieval system