KEGG   Rhodococcus sp. B7740: NY08_3356Help
Entry
NY08_3356         CDS       T03776                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
rhb  Rhodococcus sp. B7740
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase VMR2 DUF5059
Motif
Other DBs
NCBI-ProteinID: AJW41366
UniProt: A0A0D5AEU3
LinkDB All DBs
Position
complement(3470608..3471657)
Genome map
AA seq 349 aa AA seqDB search
MDLPLAVPVAPMLAKAAKVVPAQPEDGPAVWSYEPKWDGFRAIVFRDGDEVVLGSRGGKD
LARYFPELVAAIKAELPDKIVVDGEIVVPREKNGSTRLDWESLSERIHPAASRVTMLAEK
TPAQFIGFDLLAVGDEDLTAEPFSTRRARLLDAVGTGGPSCFVTSATDDAAVAEDWFERF
EGAGLDGVVAKKLDGIYLPNKREMIKIKHARTADCVLIGYRIHKSGNGIGSLLLGLYDGD
DLRMIGGASAFTDKRRLELLEELEPLRLGDDVTYDGEATRWNSSNDRNWIPVRIERVIEV
AYDQMEGARLRHVARFLRWRPDRDPRSCAYDQLEVPVRYDVADVIAGGR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggatcttcctcttgccgtgccggttgcaccgatgctcgccaaagccgcgaaagtggtg
cccgcccagcccgaggacgggcctgcggtgtggtcgtacgagccgaaatgggatgggttt
cgcgccatcgtcttccgtgacggagacgaggtggtgctcgggtcacgcggcggcaaggac
ctggcccgctacttcccggagttggtggcggcgatcaaggccgagctacccgacaagatc
gtcgtcgacggcgagatcgtcgtaccgcgcgagaagaacggttccacgcgcctcgactgg
gagtcgctgtccgaacggattcatcccgcagcgagtcgggtgacgatgctcgcggagaag
actccggcgcagttcatcggcttcgatctgttggccgtcggcgacgaggatctgacggcc
gagccgttctcgacccgccgcgcgagattgctcgacgcggtgggaacgggcggcccgagt
tgtttcgtcacctccgccaccgatgatgcggccgtggccgaggactggttcgagcgtttc
gaaggtgccgggctcgacggtgtggtggccaagaaactcgacgggatctatctgccgaac
aagcgcgagatgatcaagatcaagcatgcgcgtaccgcggactgcgtgctgatcggctat
cgaatccacaagtccggcaacggtatcggatccttgctgctcggtctctacgatggcgac
gatctgcggatgatcggcggtgcgtcggcgttcaccgacaagcgccggttggaactgctc
gaagaactcgaaccgctccgactcggtgacgacgtcacgtacgacggtgaggcgacccgc
tggaattcgtccaacgaccgcaactggataccggtgcgcatcgagcgggtcatcgaggtg
gcctacgaccagatggaaggggcgcggctgcggcacgtggccaggttcctacgctggcgg
cccgatcgtgatccacgctcgtgtgcctacgaccagctcgaggttccggtgcgctacgac
gttgccgacgtgattgccgggggacgatag

DBGET integrated database retrieval system