KEGG   Rhodococcus sp. B7740: NY08_3563Help
Entry
NY08_3563         CDS       T03776                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00220  Arginine biosynthesis
rhb00250  Alanine, aspartate and glutamate metabolism
rhb00290  Valine, leucine and isoleucine biosynthesis
rhb01100  Metabolic pathways
rhb01110  Biosynthesis of secondary metabolites
rhb01130  Biosynthesis of antibiotics
rhb01210  2-Oxocarboxylic acid metabolism
rhb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NY08_3563
   00290 Valine, leucine and isoleucine biosynthesis
    NY08_3563
   00220 Arginine biosynthesis
    NY08_3563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhb01007]
    NY08_3563
Enzymes [BR:rhb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NY08_3563
    2.6.1.66  valine---pyruvate transaminase
     NY08_3563
Amino acid related enzymes [BR:rhb01007]
 Aminotransferase (transaminase)
  Class I
   NY08_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AJW41573
UniProt: A0A0D5AFK0
LinkDB All DBs
Position
complement(3670169..3671389)
Genome map
AA seq 406 aa AA seqDB search
MTKSIDQARKLENVRYDIRGRILDKTEELEEQGHAILRLNVGNPAPFGFEAPDEIMMAMI
RNLPTAQGYSDSRGLFSARTAVVQYYQTKGLTDLDVGDIYLGNGVSELITMTMQALCNPE
DEILIPSPDYPLWTGSVALAGGVPVHYLSDENQDWAPDFDDLEAKITPRTRAIVVINPNN
PTGAVYSREVLQRFVDLAREHDLVLLADEIYEKIVYDGAVMTNLATLTGKDVLCLTYSGL
SKAYRVCGFRAGWLAITGPRRRAASFIEGITLLSNMRMCANVPAQHAIQTALGGRQSIED
LLLPAGRLTAQRDLAHRMLNSIDGISCVQAAGALYMFPKLDTERFGIVDDEKFVLDLLES
EKILVSHGRAFNWDVPDHFRLVTLPNVDDLATALDRLGNFMSSYRQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaatctatcgatcaggcgcgcaagctcgagaacgtgcgctacgacatccgtgga
cgcattctggacaagaccgaagaactcgaggagcagggacacgcgatcctgcgactcaac
gtcggtaatcctgccccgttcggtttcgaggcaccggacgagatcatgatggcgatgatc
cgcaatcttcctaccgcgcaggggtattcggactcccgcggcctgttctccgcgcgcaca
gcggtggtccagtactaccagaccaaaggcctgaccgatctcgacgtcggcgacatctac
ctcggaaacggggtctcggaactgatcaccatgacgatgcaggcgctgtgcaacccggaa
gacgaaatcctgatcccgtcgcccgactacccgctgtggaccggctcggtggccctggcc
ggtggtgtgcccgtccattatctgtccgacgaaaaccaggattgggccccggacttcgat
gacctcgaagccaagatcacgccccgcacccgcgcgatcgtggtgatcaacccgaacaat
cccaccggagcggtgtactcacgagaggtactgcagcgattcgtcgacctggcacgggag
cacgatctggttctgctcgccgacgagatctacgagaagatcgtgtacgacggggcggtg
atgaccaacctcgccaccctgaccggcaaagatgttctgtgccttacctattcgggtctg
tcgaaggcgtaccgggtgtgcggattcagggcgggatggctggcgatcaccggcccgcgc
cgacgcgcggcgagcttcatcgagggcatcacgctgctgtccaacatgcgcatgtgcgcg
aatgtgccggcccaacatgcgatacagaccgcgctcggcggcaggcagtcgatcgaggat
ctgctgctcccggcgggcaggttgaccgcgcagcgtgacctggcgcatcgcatgctcaac
tcgatcgacggaatcagctgcgtccaggcagcgggtgcgctgtacatgttccccaaactc
gacaccgaacggttcgggatcgtcgacgacgagaagttcgtgctcgacctgctcgagtcc
gagaaaattctggtcagtcacggccgtgccttcaattgggatgtgcccgatcacttccga
ctcgtcacgttgcccaacgtcgacgatctcgcgacggcactcgaccgtctgggcaatttc
atgagctcctatcggcagtag

DBGET integrated database retrieval system