KEGG   Rhodococcus sp. B7740: NY08_4405Help
Entry
NY08_4405         CDS       T03776                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00790  Folate biosynthesis
rhb01100  Metabolic pathways
Module
rhb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rhb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NY08_4405
Enzymes [BR:rhb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NY08_4405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AJW42405
UniProt: A0A0D5AHK4
LinkDB All DBs
Position
4512760..4513569
Genome map
AA seq 269 aa AA seqDB search
MGVLNVTADSFSDGGRYLDVDAAVEHGLAMHRRGVDIVDVGGESTRPGADRIDPTLEAQR
VVPVIAALAEAGVATSVDTMRASVAEAAIEAGVSIVNDVSGGRADPAMAGVVADGGLPWI
LMHWRAAGSEYRHAGPADRYHDVVADVRSELLEQVDHAVAAGVDTAMLVLDPGLGFAKNA
EHNWQLLRGLPDLVSAGFPVLVGASRKRFLGSLLADDDGSPRPPDGREVATAVVSALAVA
GGAWGVRVHDVRASLDAVAVVRAWQGDRA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtactcaacgtcactgccgattcgttctccgacggcggtcgatacctcgacgtc
gacgctgccgtcgaacacgggttggcgatgcatcgtcgcggcgtcgacatagtcgacgtc
ggtggtgagtcgacgcggcccggagcagaccggatcgatccgacactcgaggcgcagcgt
gtcgtaccggtcatcgctgcgctcgccgaagcaggggtggccaccagcgtcgacacgatg
cgtgcctcggtcgccgaggccgcgatcgaggccggggtatcgatcgtcaacgacgtctcg
ggcggtcgggcggatccggccatggccggggtggttgcggacggcggattgccgtggatc
ctgatgcactggcgagccgccggatccgaataccggcacgccggtccggccgatcggtac
cacgacgtggtcgccgacgtccgcagtgaactgctcgaacaggtcgaccacgcagtggcc
gcaggagtggacaccgcgatgctcgtgctcgacccgggcctcggcttcgccaagaacgcc
gagcacaactggcaactgctccgtggcctccccgatctggtgtcggccggcttcccggtt
ctcgtcggtgcctccaggaagcgattcctcggatcactgctggcggacgacgacggttct
ccgcgaccgccggacgggcgagaggtcgccacggccgtggtgtcggcgctcgccgtcgcc
gggggagcgtggggtgtgcgcgtgcacgacgttcgagcgtcactcgacgcggtggcggtc
gtacgggcatggcagggtgatcgggcatga

DBGET integrated database retrieval system