KEGG   Rhodovulum sp. P5: RGUI_0397Help
Entry
RGUI_0397         CDS       T04813                                 

Definition
(GenBank) Anthranilate synthase, amidotransferase component
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
rhc  Rhodovulum sp. P5
Pathway
rhc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rhc01100  Metabolic pathways
rhc01110  Biosynthesis of secondary metabolites
rhc01130  Biosynthesis of antibiotics
rhc01230  Biosynthesis of amino acids
rhc02024  Quorum sensing
Module
rhc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rhc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RGUI_0397
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    RGUI_0397
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RGUI_0397
Enzymes [BR:rhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     RGUI_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ARE38538
UniProt: A0A1V0PRJ2
LinkDB All DBs
Position
286022..286603
Genome map
AA seq 193 aa AA seqDB search
MLLLIDNYDSFTYNLVHYLGELGAETKVVRNDALNVQEAMALRPSAILLSPGPCDPAQAG
ICLALTRAAAETDIPLMGVCLGHQTIGEAFGGRVVRAGEIVHGKMGTIAHDATGVFAGLP
SPFQATRYHSLIVERESLPDCLAVNAWLDDGTIMGLCHREKPIHGVQFHPESIASEHGHR
LLKNFLDTVKEPA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgatcgataactacgacagtttcacctataacctagtgcattacctaggg
gagcttggcgcggaaacgaaggtggtgcgcaacgacgcgctgaacgtgcaggaggcgatg
gccctgcgcccctctgcaatcctgttgtcgcccggtccctgcgacccggcgcaggcgggc
atctgccttgcgctgacccgggctgcggcagagacggatatcccgctgatgggtgtctgc
cttggccatcagacgattggcgaggcgtttggcgggcgggtggtgcgcgcgggcgaaatc
gtccacggcaagatgggcaccatcgcgcatgacgccaccggggtgttcgccgggttgccg
tcgccgtttcaggcgacgcgctatcactccctgatcgtcgaacgcgaaagcctgcccgac
tgccttgcggtcaacgcctggctggacgacgggacgatcatgggcctttgccaccgcgaa
aaaccgatccacggggtgcagttccaccccgaaagcatcgcgtccgaacatgggcaccga
ttgctgaagaacttcctcgataccgtgaaggaacccgcatga

DBGET integrated database retrieval system