KEGG   Rhodovulum sp. P5: RGUI_2042Help
Entry
RGUI_2042         CDS       T04813                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rhc  Rhodovulum sp. P5
Pathway
rhc00630  Glyoxylate and dicarboxylate metabolism
rhc01100  Metabolic pathways
rhc01120  Microbial metabolism in diverse environments
rhc01200  Carbon metabolism
Module
rhc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rhc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rhc_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RGUI_2042
Enzymes [BR:rhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RGUI_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ARE40183
UniProt: A0A1V0PVL2
LinkDB All DBs
Position
1945589..1945942
Genome map
AA seq 117 aa AA seqDB search
MSVQDYKSRLSDPASRKMETFSYLPEMTDEQIRKQVEWIVKHGWNPAIEHTEPQFARSNY
WYMWKLPMFGETDVDAILAELKACHEANPDNHVRLIGYNNYTQSQGANMVVYRGTPV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcaggactacaagtcgcggctttcggatccggccagccgcaagatggagacc
ttctcctacctgcccgaaatgacggacgagcagatccgcaagcaggtggagtggatcgtc
aagcatggctggaacccggccatcgaacacaccgaaccgcaattcgcccggtccaactac
tggtacatgtggaagctgccgatgttcggggaaaccgatgtcgacgcgatcctggccgag
ctgaaggcctgccacgaggcgaaccccgacaaccatgtccgcctgatcgggtacaacaac
tacacccagagccagggcgccaacatggtcgtctatcgcggcacgcccgtgtga

DBGET integrated database retrieval system