KEGG   Rhodovulum sp. P5: RGUI_3727Help
Entry
RGUI_3727         CDS       T04813                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhc  Rhodovulum sp. P5
Pathway
rhc00240  Pyrimidine metabolism
rhc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RGUI_3727
Enzymes [BR:rhc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RGUI_3727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: ARE41868
UniProt: A0A1V0Q114
LinkDB All DBs
Position
complement(3752057..3752656)
Genome map
AA seq 199 aa AA seqDB search
MAKLHFHYSTMNAGKSTLLLQASYNYVERGMATYLLTAGVDTRAGAGRIASRIGIGAAAD
RFFPTDDLFARIADRLQAGPCACVFIDEAQFLTPEQVWQLARAADDLGVPVMAYGLRVDF
RGELFPGSATLLAIADVLREIRTICHCGRKASMVVRMGPDGQPMRDGDQVQIGGNETYVS
LCRRHWREAMGDRASGTGT
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgcatttccactactccaccatgaatgccggcaagtcgacgctgctgttg
caggcctcctacaactatgtcgaacgggggatggccacctatctgctgaccgcgggcgtc
gatacgcgggccggcgcggggcgcatcgcctctcgcatcgggatcggggcggcggcggac
aggttcttccccacagatgacctgttcgcccgcatcgcggaccggctgcaggccggcccc
tgcgcttgtgtcttcattgacgaggcgcagttcctgacacccgaacaggtctggcaactg
gcccgcgcggcggatgaccttggcgtgccggtgatggcctacgggttgcgcgtcgatttc
cggggggagctattcccgggctccgccacgcttctcgccatcgccgatgtgctgcgcgag
atccgcacgatctgccattgcgggcgcaaggcgtcgatggtggtccgcatggggccggac
ggacagcccatgcgtgacggcgatcaggtgcagatcggggggaacgaaacctatgtctcc
ctctgccgccgccactggcgcgaggcgatgggggaccgcgcgtcagggaccggaacgtaa

DBGET integrated database retrieval system