KEGG   Rhodanobacter denitrificans: R2APBS1_0606Help
Entry
R2APBS1_0606      CDS       T02495                                 

Definition
(GenBank) disulfide bond chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
rhd  Rhodanobacter denitrificans
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rhd03110]
    R2APBS1_0606
Chaperones and folding catalysts [BR:rhd03110]
 Heat shock proteins
  HSP33
   R2APBS1_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AGG87774
UniProt: I4WSU9
LinkDB All DBs
Position
666043..666942
Genome map
AA seq 299 aa AA seqDB search
MENLPAEDVLHRFLLERAGVRGTLLRLGPAWREVAGRADYPPALHALLGEALAASALLTG
GIKLDGALSIELKSAGALRLLFAECSDQGRLRGLARWNEPLPAPLALDALAGAIMAITIG
NVDRGQRYQGLVDLRHADLAASLEDYFTKSEQLPARILLAADGEQAVGLMLQKMPGEGGH
AVVQDDDAWNRVVHLTATLGTQELLASAPEQLLYRLYHEESVRLFEPRPLAFGCSCSRER
VTAMLRSLGRDEVEAALAARGDEIEVVCEFCAQRYHFDRIDAEHLLSEAAAPGAPGTAQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaacctgcctgccgaagacgtgctgcatcgctttctgctggaacgcgccggggtg
cgcggtaccctgctgcggctggggccggcctggcgcgaagtggccggtcgcgccgactac
ccgccggcactgcacgccctgctgggcgaggcgctggccgccagtgcgctgctgaccggc
gggatcaagctcgacggcgcgctgtcgatcgagctgaagagcgcgggcgcgttgcgcctg
ctgttcgccgagtgcagcgaccagggccgcctgcgcgggctggcgcgctggaacgaaccg
ctgcccgcgccgctggcgctggatgcgctggccggcgcgatcatggccatcaccatcggc
aacgtcgatcgcggtcagcgctaccagggcctggtggacctgcgccacgccgacctggcc
gcttcgctggaagactacttcacgaagtccgagcagttgccggcgcggatcctgctggcc
gccgacggcgagcaggcggtcggcctgatgctgcagaaaatgccgggcgagggcggccac
gccgtggtgcaggacgacgatgcgtggaatcgcgtggtgcacctgaccgccaccctgggc
acgcaggaactgctggccagcgcgccggagcaactgctgtaccgcctctaccacgaggag
tcggtgcgcctgttcgagccgcgtccgctggcgttcggctgcagctgcagccgcgagcgg
gtcacggcgatgctgcgctcgctcggccgcgacgaggtggaggcagcactggccgcccgc
ggtgacgagatcgaggtggtctgcgagttctgtgcgcagcgctatcacttcgaccggatc
gacgccgaacacctgttgagcgaagctgcggcacccggcgcgccgggcacggcacagtag

DBGET integrated database retrieval system