KEGG   Rhodanobacter denitrificans: R2APBS1_1506Help
Entry
R2APBS1_1506      CDS       T02495                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhd  Rhodanobacter denitrificans
Pathway
rhd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    R2APBS1_1506
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhd02000]
    R2APBS1_1506
Enzymes [BR:rhd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     R2APBS1_1506
Transporters [BR:rhd02000]
 Other Transporters
  Pores ion channels [TC:1]
   R2APBS1_1506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AGG88651
UniProt: M4NLN6
LinkDB All DBs
Position
1643111..1643731
Genome map
AA seq 206 aa AA seqDB search
MKLYYSPGACSLSPHIVALEAGIALPLEKVDGKAKRTEGGADFWQVNPKGYVPALALDNG
ELLTEGPAIVQYLADLKPESGLAPANGTLARYRLQEMLGYINSEIHKSYSPLFKPDTPEA
TRAERKEYLTKRYQFIEGALAKQPFLLGDKFTAADAYLFTVTNWARHVDLDLSGFPALLA
FQKRVAARPAVQAALEAEGLVKKALA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattactcgccgggcgcctgctcgctgtcgccgcacatcgtggcgctggaa
gccggcatcgcgctgccgctggagaaggtcgacggcaaggccaagcgtaccgagggcggc
gcggatttctggcaggtcaacccgaagggctacgtgccggcactggcgctggacaacggc
gaactgctgaccgaaggcccggcgatcgtgcagtacctggccgacctcaagcccgagagc
ggcctggcgcccgccaacggcacgctggcgcgctaccgcctgcaggagatgctgggctac
atcaactcggagatccacaagagctacagcccgctgttcaagcccgacacgcccgaagcc
acccgcgccgagcgcaaggagtacctgacgaagcgttaccagttcatcgagggtgcgctg
gcgaagcagccgttcctgctgggcgacaagttcaccgcggccgacgcctacctgttcacc
gtgaccaattgggccaggcacgtcgacctggacctgtccggcttcccggcgttgctggcg
ttccagaagcgcgtggccgcgcgccccgcggtgcaggcggcgttggaggccgagggcctg
gtgaagaaggctctcgcctga

DBGET integrated database retrieval system