KEGG   Rhodanobacter denitrificans: R2APBS1_1543Help
Entry
R2APBS1_1543      CDS       T02495                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rhd  Rhodanobacter denitrificans
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    R2APBS1_1543
Enzymes [BR:rhd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     R2APBS1_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 AlaDh_PNT_C Glutaredoxin HI0933_like DAO FAD_binding_3 Thi4 K_oxygenase FMO-like NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AGG88686
UniProt: M4NLR8
LinkDB All DBs
Position
complement(1687874..1689484)
Genome map
AA seq 536 aa AA seqDB search
MLDANLKTQLKAYLEKVTQPIEIVASLDDSAKSAELNELLEGIAALSDRISLVRRDDDQR
KPSFAINRVGTDIGVRFAGIPLGHEFTSLVLALLQVGGHPSKVAADVIEQVKNLDGPAPD
GVFRFETYFSLSCQNCPDVVQALNLMSVLNPKIRHVAIDGALYQDEVEARQIMSVPTVYL
NGEVFGQGRMSLEQIVAKLDTGASAREAGKIAAKDAFDVLVVGGGPAGAAAAIYAARKGI
RTGVAAERFGGQVLDTMAIENFVSVDYTEGPKLGTALEQHVKNYDVDIMNLQRAEKLVPP
GEPGGLIEVQLANGAALKSKTVILSTGARWRQMDVPGEEEYLNKGVAYCPHCDGPLFKGK
RVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDGKLRADEVLQRKLRSLPNVDVIVSAQSTE
VLGDGQKVTGLVYKDRTDGVMHSLALEGIFVQIGLLPNTEWLKGTLELSPRGEIVIDARG
QTSLPGVFAAGDATTVPYKQIVIAMGAGSTAALSAFDHLIRSPLATTENRKEAVAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaacctcaagacccagttgaaggcctatctggaaaaggtcacgcagccg
atcgagatcgttgcgtccctggacgacagcgccaagtccgccgaactgaacgaattgctc
gagggaatcgccgcgctgtccgaccggatcagcctggtccgccgcgacgacgaccagcgc
aagccctcgttcgcgatcaaccgcgtcggcaccgacatcggcgtgcgcttcgccggcatt
ccgctgggccacgaattcacctcgctcgtgctggccctgctgcaggtcggcggccatccg
tccaaggtcgcggccgacgtgatcgagcaggtgaagaatctcgacggcccggcccctgat
ggcgtattccgcttcgagacctatttctcgctgtcctgccagaactgcccggacgtggtg
caggcgctgaacctgatgagcgtgctgaatccaaagatccggcacgtcgccatcgacggc
gcgctgtaccaggacgaggtcgaagcgcgccagatcatgtcggtgccaaccgtttatctc
aacggcgaggtgttcggccagggccgcatgagcctggaacagatcgtggcgaaactcgac
accggcgccagtgcccgcgaggccgggaagatcgcggccaaggacgcgttcgacgtgctc
gtcgtcggcggcggcccggccggcgccgcggcggcgatctacgccgcacgcaagggcatc
cgcaccggcgtggcggccgagcgcttcggtggccaggtgctggacaccatggcgatcgag
aacttcgtctcggtcgactacaccgaaggcccgaagctgggcacagcgctggagcagcac
gtcaagaactacgacgtggacatcatgaacctgcagcgcgccgagaagctggtgcccccg
ggcgaacccggcggcctgatcgaggtgcaactggccaacggcgccgcgctgaagtcgaag
acggtgatcctctccaccggcgcgcgctggcggcagatggacgtacccggcgaagaggaa
tacctcaacaagggcgtggcctactgcccgcactgcgacggcccgctgttcaagggcaag
cgcgtggcggtgatcggcggcggcaactccggcgtggaggcggcgatcgacctggccggc
atcgtggcccacgtcaccctgctcgagttcgacggcaagctgcgtgcggacgaggtgctg
cagcgcaagctgcgcagcctgcccaacgtcgacgtgatcgtcagtgcgcagagcaccgaa
gtgctgggcgacgggcagaaggtcaccggcctggtctacaaggaccgcaccgacggcgtg
atgcacagcctcgcgctggaaggcatcttcgtgcagatcggcctgctgccgaacaccgag
tggctgaaaggcacgctggaactcagcccgcgcggcgagatcgtgatcgacgcgcgcggc
cagacctcgctgcccggcgtgttcgccgccggcgacgccaccacggtgccgtacaagcag
atcgtgatcgcgatgggtgccggttccaccgctgcgctgagtgcgttcgaccacctgatc
cgcagcccgctggccaccacggaaaacaggaaggaagcggtcgccgcctga

DBGET integrated database retrieval system