KEGG   Rhodanobacter denitrificans: R2APBS1_3090Help
Entry
R2APBS1_3090      CDS       T02495                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rhd  Rhodanobacter denitrificans
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rhd01001]
    R2APBS1_3090
Enzymes [BR:rhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     R2APBS1_3090
Protein kinases [BR:rhd01001]
 Serine/threonine kinases: Other
  Bacterial family
   R2APBS1_3090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr HAMP sCache_3_2 Pkinase_fungal CHASE8 APH UbiA DUF2222
Motif
Other DBs
NCBI-ProteinID: AGG90162
UniProt: M4NJ84
LinkDB All DBs
Position
complement(3227444..3229147)
Genome map
AA seq 567 aa AA seqDB search
MSEVAIPQQVGRYRIEGVLGEGAMAVVYAGFDPDIERKVAIKCLHREIAADPVYRRRFLV
EARAAGHLTHPHIVTIFDVGETDDGRSYIAMERLSGETLASAVTREGFPSLPVIIDLVGQ
LAAALDYAHARGVLHHDVKPENIMLADGWSYAKISDFGIAERRGVLRDAGGVSAEVGGTP
AYMALERLRGERTDARSDLFSLGVVLYWLLTGKLPWPDIGNPQQLVRKRLRSPRPPIRPR
DPATPSILVSIVRTLLAPAAESRYQRGAEVIEDLRLAAREYEREREDPLATRIISLRLRW
ASSLGAILSLVLVLGLAAIYAKQSAAVTGVALDFGSSMGRMIASESAENLLLGDQAATRA
LVTDVSRNRQIRYLAIADRDGGVIASTQPQEVGQRLSAPDGEKYLPRSGDIQSYLSRTAG
GREQGGMLLFDVPIHYQAKTVGDLRLGISNAALRAAQRTTLWVIAVVLVLTLAAVVGAAY
WLFRRPLNTLDLLGDALLKVARGDFRHRIRLARRDELGRLFAAFNLMNGALQARQHRSGM
AAPAAVEDVTRPTRIMSAASEEGAGES
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaggtcgccatcccgcagcaggtcggccgctaccgcatcgagggtgtcctcggc
gaaggcgcgatggcggtcgtctatgccggcttcgacccggacatcgagcgcaaggtggcg
atcaagtgcctgcaccgcgagattgccgccgatcccgtctaccggcgccgcttcctggtc
gaggcgcgcgccgccggccacctgacccacccgcacatcgtcaccatcttcgacgtcggc
gagaccgacgacggccgttcgtacatcgcgatggagcggctttcgggcgagacgctcgcc
agcgcggtcacccgcgaaggctttccgtcgctgccggtgatcatcgacctggtgggtcag
ctcgccgcggcgctcgactatgcgcatgcgcgcggcgtgctgcaccacgacgtcaagccc
gagaacatcatgctggccgacggctggagctacgccaagatcagcgacttcggcatcgcc
gagcgccgcggcgtgctgcgcgatgccggcggggtatccgcggaagtcggcggcaccccg
gcctacatggcgctggagcgcctgcgcggcgagcgcaccgacgcgcgcagcgacctgttc
tcgctgggcgtggtgctgtactggctgctcaccggcaagctgccgtggccggacatcggc
aacccgcagcaactggtcaggaagcgcctgcgttcgccgcgcccgccgatccgcccgcgc
gacccggccacgccgtcgatcctggtcagcatcgtgcgcaccctgctggcgcccgcggcg
gagtcgcgctaccagcgcggcgccgaggtcatcgaggacctgcgcctggccgcgcgcgag
tacgagcgcgagcgggaagacccgctggcgacccgcatcatttccctgcgcctgcgctgg
gccagcagcctgggcgcgatcctgagcctggtgctggtgctgggactggccgcgatctac
gccaagcagagcgccgcagtgaccggcgtggcgctggatttcggcagctcgatggggcgc
atgatcgccagcgagtcggccgagaacctgctgctcggcgaccaggccgccacccgcgcg
ctggtcaccgacgtttcgcgcaaccggcagatccgctacctggcgatcgccgaccgcgac
ggcggcgtcatcgccagcacgcagccgcaggaggtcggccagcggctgtccgcgccggat
ggggaaaagtacctgccgcgatcgggcgacatccagagctacctcagccgcaccgcgggc
gggcgcgagcagggcggcatgctgttgttcgacgtgccgatccattaccaggccaagacg
gtgggcgacctgcgcctgggcatcagcaatgcggcgctgcgtgcggcacagcgcaccacg
ttgtgggtgatcgccgtggtgctggtgctgaccctggcggccgtggtcggcgcggcctac
tggctgttccgtcgcccgctcaacacgctggacctgctgggcgacgcgttgctgaaggtg
gcgcgcggcgactttcgccatcgcatccggctggcccgccgcgacgagctgggccgcctg
ttcgccgccttcaacctgatgaacggcgcgctgcaggcccgccagcaccggtccggaatg
gccgcgccggctgccgtcgaggacgtcacgcgaccgacgcggatcatgtcggcggccagc
gaagagggcgccggcgagtcctga

DBGET integrated database retrieval system