KEGG   Rhodanobacter denitrificans: R2APBS1_3758Help
Entry
R2APBS1_3758      CDS       T02495                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
rhd  Rhodanobacter denitrificans
Pathway
rhd00061  Fatty acid biosynthesis
rhd00780  Biotin metabolism
rhd01100  Metabolic pathways
rhd01212  Fatty acid metabolism
Module
rhd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    R2APBS1_3758
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    R2APBS1_3758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhd01004]
    R2APBS1_3758
Enzymes [BR:rhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     R2APBS1_3758
Lipid biosynthesis proteins [BR:rhd01004]
 Fatty acid synthase
  Component type
   R2APBS1_3758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AGG90817
UniProt: M4NL64
LinkDB All DBs
Position
4016163..4017356
Genome map
AA seq 397 aa AA seqDB search
MTPLAVTAYTATSAMGSGLAAQLDALEHARSGLRPNDIGSAPLTCWIGRVEGVEDTVLPA
ALAAWDCRNNRLAWLGLNQDGFLERVRAARARYGADRVALLLGTSTASIGATEEAYRRLD
ADGGFADDLLRPAIHAPHSLAAFVAAALALEGPCLTVSTACSSSAKVFASAERMLRLGLV
DAAVVGGVDTLCDSVLFGFNALELVSPEPCRPFDATRSGISIGEAAGFALLERAEVAPAA
LRLLGYGEASDAHHMSTPHPQGLGAELALHDALARSGLDAARVDYINLHGTASLKNDKVE
AALVARVFPASTRASSTKGYTGHTLGAAGIVEATVALQAIAHGLIPGNLGGNTPDPICGA
QFAWRNERRRVDVALSNSFGFGGNNACLAFARAGFAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgctcgcggtcaccgcgtacaccgccacctccgccatgggcagcggcctcgcg
gcgcagctcgacgcgctcgagcacgcccgcagcggcctgcgcccgaacgacatcggcagc
gcgccgctgacctgctggatcggccgggtcgagggcgtggaagacaccgtgctgcccgcc
gcgctcgccgcctgggattgccgcaacaatcgcctggcctggctggggttgaaccaggat
ggcttcctcgaacgcgtgcgggcggcgcgtgcacgctacggcgccgaccgcgtcgcgctg
ctgctgggcacgtccaccgccagcatcggagccaccgaggaagcctatcgccggctcgat
gccgacggcggcttcgccgacgacctgctgcgcccggcgatccacgcaccgcattcgctg
gctgccttcgtcgccgccgcgctggcgctggaagggccgtgcctgaccgtctccaccgcc
tgctcgtccagcgccaaggtgttcgccagcgccgagcggatgctgcgcctcggcctggtc
gacgcggcggtggtcggtggcgtggacaccctgtgcgacagcgtgctgttcggcttcaac
gcgctggagctggtgtcgcccgagccgtgccgcccgttcgacgccacgcgcagcggcatc
tcgatcggcgaggcggccggcttcgccctgctggaacgcgcggaggtggcgcccgccgca
ctgcgattgctcggttacggcgaggccagcgacgcgcaccacatgtccaccccacacccg
cagggcctcggtgccgagctggccctgcacgacgcgctggcccgcagcggcctcgacgcg
gcgcgggtggattacatcaacctgcacggcaccgccagcctgaagaacgacaaagtggag
gcggcgctggtggcgcgcgtgttcccggccagcacacgggccagttcgaccaagggctac
accggccacacgctgggcgccgccggcatcgtcgaggccaccgtcgcgctgcaggcgatc
gcgcacggcctgatcccgggtaacctcggcggcaacactcccgatccgatctgcggcgcg
cagttcgcctggcgcaacgagcgccggcgcgtcgacgtggcgctcagcaactcgttcggc
ttcggcggcaacaacgcctgcctcgcgttcgcccgtgcggggttcgccgcatga

DBGET integrated database retrieval system