KEGG   Rickettsia heilongjiangensis: Rh054_01010Help
Entry
Rh054_01010       CDS       T01587                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
rhe00020  Citrate cycle (TCA cycle)
rhe00190  Oxidative phosphorylation
rhe00650  Butanoate metabolism
rhe01100  Metabolic pathways
rhe01110  Biosynthesis of secondary metabolites
rhe01120  Microbial metabolism in diverse environments
rhe01130  Biosynthesis of antibiotics
rhe01200  Carbon metabolism
Module
rhe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rhe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rh054_01010 (sdhA)
   00650 Butanoate metabolism
    Rh054_01010 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rh054_01010 (sdhA)
Enzymes [BR:rhe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rh054_01010 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Rh054_01010 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEK74212
UniProt: G0GWV3
LinkDB All DBs
Position
173951..175741
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKSIKEASLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRTQ
EVLDEGAGMISEIRSSYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDGDWMKHTLSSIDEAGKVVLDYKPVTLTTLTDEVTAVPPVKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatatcattcatcataaatttgatgtagtagttgtaggtgcaggc
ggagcaggtcttcgttctgcattcggtatggctaaagaagggctaaataccgcttgtata
actaagctgttcccaacccgtagtcatactgtggctgctcagggtggaattagtgcagct
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatacggtaaaaggttct
gattggttaggcgatcaggatgccattgagtatatgtgcaaaaacgctcccgatgcgatt
ttagagctagagcattacggcgtacctttctcaagaactgaagagggaaaaatttatcag
cgtccttttggaggaatgacaacagagtacggcaaaggaaaagcagctcagcgtacgtgt
gctgcggcagatcgtacggggcatgccatacttcatactttatatcaacagtcactaaaa
cataaagtacagtttttcgttgagtattttgctattgatttattgatggaagatggtgaa
tgtagaggcgtagttgcgtggaatttagatgatggtagtctgcattgttttagagctcat
aatgtagtgcttgcaacgggcggatacgggcgtgcttatttttcggcgacgtctgctcat
acttgtacgggtgatgggggcggcatggcgattagagccggtcttccactgcaagatatg
gaatttgtacagttccatccgacaggtatatattcggcaggctgtcttattaccgagggg
gcaagaggtgaagggggatatctcgttaatgcaaacggtgagcgttttatggagcgttat
gctcctgctgcaaaggatttagcttcaagagatgtagtttcaagagcaatgactatagaa
atcagagaggggcgaggagtcggcgagcataaagatcatgtatttttacatttaaatcat
ttatcgcctgagattttacatagtcgtttgcccggtatctctgagacagctaaaattttt
gccggtgttgacgtgactaaagagccgataccggtgcttcctacggtacattataatatg
ggtgggataccgacgaattatcacggtcaagtcataatcaaagacggtaaaaatcataat
agcgtagtaaaagggcttatggcaatcggtgaagcggcttgcgtatcggtacacggtgct
aaccgattaggatcaaattctttgcttgatttagtagtatttggtagaagttctgcatta
aaagcagccgagcttattaagcctgcgagtccccacaagtctataaaagaagcaagcctt
gaaaaaattataaatagatttgataaagtccgtcacgctaacggtaatattttagttgca
gagttaaggcttaaaatgcaaagaactatgcaaagccatgcttcggtatttagaactcaa
gaggtactagatgaaggagcaggaatgattagtgaaataagaagcagttataaagatata
aaaattaacgataaatctttaatttggaatagcgatttagtggaagccttagagctagat
aatctacttgatcaagctttagtaacggtatattcggcagctgcaagaaaagaaagcaga
ggagctcatgcacgtgaagattatcctgatcgtaatgatggggattggatgaagcatact
cttagctctatcgatgaagcaggtaaagtagttcttgattataaacctgtgactttaact
actttaaccgatgaagtaacagcagtcccgccggtgaagagagtgtactga

DBGET integrated database retrieval system