KEGG   Rickettsia heilongjiangensis: Rh054_01905Help
Entry
Rh054_01905       CDS       T01587                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
rhe00473  D-Alanine metabolism
rhe00550  Peptidoglycan biosynthesis
rhe01100  Metabolic pathways
rhe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rh054_01905 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rh054_01905 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Rh054_01905 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhe01011]
    Rh054_01905 (ddl)
Enzymes [BR:rhe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rh054_01905 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rhe01011]
 Precursor biosynthesis
  Amino acid ligase
   Rh054_01905 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 RimK CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEK74379
UniProt: G0GXC0
LinkDB All DBs
Position
340588..341553
Genome map
AA seq 321 aa AA seqDB search
MHKYQTHWVEHSIVKILSSTGKKHIALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFI
DMGADIAVRLQERKPDIVFNCLHGTYGEDGCLPGLLNIMRIPYTHSGVLSSALAFNKIHS
RSWFLTNNINMAESIVVNKSDNIKNDPMKRPYVIKPLTQGSSIGVEVIFAEDDFNFADYD
FPYGDQVIIEQYIKGRELQVAVLNGKALGALEIKLLKNRFYDYETKYTEGFADHLCPVPL
PANLYEKLLIESEKIYKTMNCKGPARAEFILEEQTNKLYALEINTHPGMTPLSIVPEIAA
YAGINFTNLIEEIIKTASFES
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcataaatatcaaacacattgggtagaacactctatagtcaaaatattaagtagtacc
ggtaaaaagcatatagcattaatggcgggcggtatgtctgctgagcgtgaagtatcgtta
gtgtcaagcgaaggagttagtaaagctttaattgaattaggatatagagttacctttatt
gatatgggagcggatattgcagttagattacaagaaagaaaacctgatatcgtttttaat
tgtctgcacggtacatatggtgaagacggttgtttaccaggattacttaatataatgcgg
attccttatactcatagcggcgtgttatcttcagctttagcattcaataaaatacattct
aggagctggtttttaacgaataatattaatatggcagaaagcattgttgtaaataaaagc
gataatataaaaaatgatcctatgaaacgaccgtacgttattaagcctcttacacaaggt
tcaagtattggtgttgaggtgatatttgcagaagatgattttaactttgccgattatgat
tttccttacggtgatcaggtaataatagaacaatatataaaagggcgagaattacaagta
gcggtattaaacggcaaagctcttggagctttagagattaaattactaaagaatcgtttc
tatgattatgaaactaaatataccgaaggatttgctgatcatctttgtcctgttccgcta
cctgctaatttatatgagaaattacttatagaatcagaaaaaatttataaaacaatgaat
tgtaaaggtcctgctagagcagagtttattttagaagagcaaacaaacaagttatatgct
ttggagataaatactcacccaggtatgacgcctttatcaatagtgccggaaattgcagct
tatgcagggataaattttactaacttaattgaagaaattataaagacggcaagctttgaa
tcatga

DBGET integrated database retrieval system