KEGG   Rodentibacter heylii: FEE42_07440
Entry
FEE42_07440       CDS       T06473                                 

Gene name
rfaC
Definition
(GenBank) lipopolysaccharide heptosyltransferase RfaC
  KO
K02841  heptosyltransferase I [EC:2.4.-.-]
Organism
rhey  Rodentibacter heylii
Pathway
rhey00540  Lipopolysaccharide biosynthesis
rhey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    FEE42_07440 (rfaC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rhey01005]
    FEE42_07440 (rfaC)
Enzymes [BR:rhey01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     FEE42_07440 (rfaC)
Lipopolysaccharide biosynthesis proteins [BR:rhey01005]
 Core region
  FEE42_07440 (rfaC)
SSDB
Motif
Pfam: Glyco_transf_9 Epimerase_2 UPF0181 Thioredoxin_9 CytoC_RC
Other DBs
NCBI-ProteinID: QIA77207
LinkDB
Position
complement(1481438..1482397)
AA seq 319 aa
MKICLIKTSSMGDVIHTLPALTDAQQMIPNLTVDWVVEENFAEIPQWHSALHQVIPIALR
RWRKSPFSSQTKNEWKIYRTLLQKERYDAVIDAQGLFKSAFFATRLANGTTHGYDCHSIR
EPIASFFYEKKYAISYQQHAVERIRQLFALSLNYELPHSQGDYGIAQHFTAASIEPYVIF
FHATTRDDKHWLESEWENLIEKMTALSVQIRLPWGNEKEKERAERLAKNYPNVQVLPKLT
LTELAKQIANATAVVSVDTGLSHLTAALDKPNITLYGATDPTLIGCYGKNQQYLSASSMA
EISAEQVFSRLEPLLNGNQ
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaaaatttgtttaattaaaacttcctctatgggtgatgtgatccacacattgcctgca
ttaaccgatgcccaacaaatgatcccaaatttaaccgtggattgggtggtagaagaaaat
tttgccgaaattccccaatggcattcggctcttcatcaagtgatacccattgccttacgc
cgttggcgtaaatcccctttttcctcacaaacaaaaaatgagtggaaaatttaccgcact
ttactccaaaaagaacgttatgatgccgttattgacgctcaaggattatttaaaagtgca
ttttttgctacccgtctcgctaacggcacaacgcatggctatgattgccatagcattcga
gagccgattgcttcctttttttatgagaaaaaatacgcaatttcttatcagcaacacgcc
gttgaacgtattcggcagttatttgcactaagccttaattatgaattgccgcattcgcaa
ggtgattacggcatcgcacaacattttactgccgcctccattgagccttatgtgattttt
tttcatgccactacccgagatgataaacattggcttgaatcggaatgggaaaatttaatt
gaaaaaatgaccgcactttccgtgcaaatccgtttaccttgggggaatgaaaaagaaaaa
gagcgggcggaacgcttggcaaaaaattatccgaatgttcaagtactgccaaaactaacg
ctcaccgaattggcaaagcaaattgcgaatgcgactgcggtagtctctgtggatacgggc
ttgtcgcatttaaccgcggctttagataaaccgaatattaccctttatggtgcaacagat
ccgaccttaatcggttgttatggtaagaatcagcaatatttatctgcctcaagtatggct
gaaatctcagccgaacaagtattttcaaggcttgaacctctattaaatggcaatcagtaa

DBGET integrated database retrieval system