KEGG   Rodentibacter heylii: FEE42_12425
Entry
FEE42_12425       CDS       T06473                                 

Definition
(GenBank) response regulator
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Organism
rhey  Rodentibacter heylii
Pathway
rhey02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhey00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FEE42_12425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rhey01001]
    FEE42_12425
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rhey02022]
    FEE42_12425
Enzymes [BR:rhey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     FEE42_12425
Protein kinases [BR:rhey01001]
 Histidine kinases
  OmpR family
   FEE42_12425
Two-component system [BR:rhey02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   FEE42_12425
SSDB
Motif
Pfam: HKR_ArcB_TM HATPase_c Response_reg HisKA Hpt HATPase_c_3 MOR2-PAG1_C DUF1840
Other DBs
NCBI-ProteinID: QIA78071
LinkDB
Position
2560950..2562791
AA seq 613 aa
MKNFKYFAQRYVDWVIKLGRVRFSLLGLFILAVLALSAQILLSLFITNQIDWMVLVRSII
FGLLTAPFVIYFLTLLVEQLERSRLDLSKTVLRLRNEVSERIIAEKKLSIALDKLEKNNR
EKSSLLATISHELRTPLNGIIGLSHILLDDQLSEQQRNYLKTINLSAVNLGHIFSDIIDL
DKFDTKRLKLNLEPINLNELLNDIQNFAILMVEPKNLKFILDVEPHLPDLLYLDRARLSQ
ILLNLIANAVKFTEKGTIKLTIQSLEKDIYRFSVSDTGIGIAQCEQDNIFKMYYRVKENT
NRSSGSGIGLAISKNLALLMKGDIQVESRLGQGSTFDLTIYAKEAHPINHCEPIQPLNLS
VLLVEDIELNVLVAKSVLEKLGHSVDVAMNGKDAIKLFERNTYDIILLDIKLPDMSGFDI
AAYLRKKYEDGIYDFLPPLVAFTANVMQSEEEYQSKGMDSVLRKPLALDELKRCFYHFFG
EGNIKSIDSKAVEKQSSYQSLNLELIELLGKTQTERNLVLFKQMMPAYLQELNEAFKVYL
SDHTADQSVADVAHKIKGAAGSVGLSRLQQLAEKMQCNQEEGWNDNIENWLRELNSYWQV
NVEELEDYLNSVG
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgaaaaactttaaatattttgcgcaacgatatgtcgattgggttataaaactcggacgt
gttcggttttccctacttggattattcattctcgccgtcttagcgttgagtgcacagatt
ttacttagtctatttattactaatcaaattgattggatggtgcttgtccgttcaattatc
ttcgggcttctcactgcgcctttcgttatttattttttgactttactggttgaacaatta
gaacgctcaagattggatctgtctaaaacggtattacgtttacgaaatgaagtatcggaa
agaattatcgctgaaaagaaactttctattgccttagataaattagaaaaaaataatcga
gaaaaaagtagcttacttgcgactattagtcatgaattgcgaacaccgcttaatggtatt
attgggttgagccatatcttattggatgatcagctttcagagcagcagcgtaattattta
aaaacaattaacttaagtgcggtcaatttaggacatatttttagcgatattattgattta
gataagtttgatacaaaacgtctaaaattgaaccttgaaccgattaatttgaatgaatta
ttgaatgatattcaaaattttgccattttaatggtcgaacctaaaaatcttaaatttatt
ttagacgttgaacctcatttaccggatttgctttatttggacagagcacgtttgagtcaa
attcttttaaatttgattgctaatgcagtgaagtttactgaaaaaggcacaattaaactc
actattcagtctttagaaaaagatatttatcgttttagtgtttctgataccggcataggg
atcgcccaatgtgagcaggataacattttcaaaatgtattatcgtgtgaaagaaaataca
aatcgatcttccggtagtggaatagggcttgcaatatcaaaaaatctcgccttattaatg
aaaggcgatattcaagtcgaaagccggcttggtcagggttcaacctttgatctgactatc
tatgctaaagaagctcatccaattaatcattgtgaacctattcaaccgttgaatttatcg
gttttattagttgaagatattgaattaaatgttcttgtcgcaaaaagtgtattggaaaaa
ctgggacatagtgttgatgttgcgatgaatggaaaagacgcgattaagctttttgaacgc
aatacttacgatattatattgcttgatattaaattaccggatatgtcgggttttgatata
gccgcttatctacgtaaaaaatacgaagacggcatttatgattttctcccacctcttgtt
gccttcacggcaaatgtgatgcaaagtgaagaggagtaccaaagtaagggaatggattcg
gttctgcgtaaacctctcgccctagatgagttaaaacgttgtttttatcatttttttggt
gaaggaaatataaaaagtatcgattctaaagccgtagaaaaacagtcatcctatcagtct
ttaaacctggaactgatagaactgttaggtaaaacgcaaaccgaacggaatttagtcttg
tttaaacaaatgatgccggcatatcttcaagaacttaatgaagcctttaaggtttatttg
tcggatcacaccgccgatcaaagtgttgcggatgtggcgcataaaattaaaggagcagca
ggttctgtcggattaagcagattacagcaacttgcggaaaaaatgcaatgtaatcaggaa
gagggctggaacgataatattgaaaattggcttcgtgaactgaatagttactggcaagtt
aatgtcgaagaattggaagattatttgaattctgttggataa

DBGET integrated database retrieval system