KEGG   Rodentibacter heylii: FEE42_12580
Entry
FEE42_12580       CDS       T06473                                 

Gene name
msbB
Definition
(GenBank) lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase
  KO
K02560  lauroyl-Kdo2-lipid IVA myristoyltransferase [EC:2.3.1.243]
Organism
rhey  Rodentibacter heylii
Pathway
rhey00540  Lipopolysaccharide biosynthesis
rhey01100  Metabolic pathways
Module
rhey_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:rhey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    FEE42_12580 (msbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rhey01005]
    FEE42_12580 (msbB)
Enzymes [BR:rhey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.243  lauroyl-Kdo2-lipid IVA myristoyltransferase
     FEE42_12580 (msbB)
Lipopolysaccharide biosynthesis proteins [BR:rhey01005]
 Lipid A
  FEE42_12580 (msbB)
SSDB
Motif
Pfam: Lip_A_acyltrans Wzy_C
Other DBs
NCBI-ProteinID: QIA78100
LinkDB
Position
2599801..2600754
AA seq 317 aa
MTDSQQNLRLTARVGYEPHFSWSYLKPKYWGIWLGIFFLLLLAFIPFRLRDKFAAKLGVW
IGYKARKQRKRAQINLSYCFPDWTEQQREQVIDKMFAVVAQVMFGIGEIALRSKKHLQQR
SKFIGIEHIQKAKAEGYNIILMVPHGWAIDASGIILHTHGMPMTSMYNPHRNPLVDWLWT
ITRQRFGGKMHARQNGIKAFLNDIRKGEMGYYLPDEDFGAEQSVFVDFFGTYKATLPGLN
KMAKLAKAVVIPMFPRYNSESGKYEMEIHPAMNLSEELQSARAMNKEIESFVTPSPEQYV
WILQLLRTRKDGEDLYD
NT seq 954 nt   +upstreamnt  +downstreamnt
atgacagattctcaacaaaatttacgtttaactgcgcgtgtgggctatgagcctcacttt
tcgtggtcatatttaaaaccgaaatactggggcatttggctcggtattttctttttactt
ttattggcatttataccgtttcgtttgcgtgataaatttgcggcaaaattaggtgtatgg
attggatataaagcaagaaagcagcgaaaacgggctcaaattaacttgagctattgtttc
cctgattggacagaacaacagcgtgaacaagtgattgataaaatgtttgcagtcgttgcg
caggtgatgtttggtattggagagattgcactacgttctaaaaaacatctacaacaacgt
agtaaatttattggtattgagcatatccaaaaagccaaagcagagggctataacattatt
ttaatggtaccgcacggctgggcgattgatgcttccggcattattttacatactcatgga
atgccaatgacttctatgtataacccgcatcgtaatcctttagttgactggctttggaca
ataacccgccagcgttttgggggaaaaatgcatgcccgtcaaaatggtattaaggctttt
ttgaatgatattcgcaaaggagaaatgggatattacttgccggatgaagattttggtgca
gagcaaagcgtctttgtagatttttttggtacttataaggcaactttaccgggcctaaat
aaaatggctaaactcgcaaaggctgtggtaatcccaatgttccctcgttataactcggaa
agcggtaagtatgaaatggaaattcacccggcaatgaaccttagcgaagaattgcaatca
gcccgagcaatgaataaagagattgaatcctttgttacgccgagtcctgaacaatatgtt
tggattttacaattattaagaacacgtaaagatggtgaagatctttatgattaa

DBGET integrated database retrieval system