KEGG   Rhodoferax sp. CHu59-6-5: EUB48_02635Help
Entry
EUB48_02635       CDS       T06165                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rhf  Rhodoferax sp. CHu59-6-5
Brite
KEGG Orthology (KO) [BR:rhf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EUB48_02635 (ahpF)
Enzymes [BR:rhf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EUB48_02635 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored DAO FAD_binding_2 Glutaredoxin FAD_binding_3 HI0933_like Thi4 DUF1707 AlaDh_PNT_C K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: QDL36318
UniProt: A0A515D7F8
LinkDB All DBs
Position
553779..555356
Genome map
AA seq 525 aa AA seqDB search
MLDTNLRAQLKAYLERVKLPFEIIASLDDSAAAREMHGLLSDIVSLCDKITLRTDGTDVR
KPSFALAGAGEAPRIRFAAIPLGHEFASLVLALLQVGGHPPKIETALIEQIRNLEGEFRF
ETYMSLSCHNCPDVVQALNLMAVLNPRVHSVVIDGALYQQEVTERQVMAVPMVFLNGEHF
GQGRMDVEEIVARLDTGTAARDAARLNAKQAYDVLIVGGGPAGAAAAVYAARKGIRTGML
AERLGGQTMDTMGIENFVSVLETDGPKFAAALEQHARLYEVDILNLQRAEKLIPATDNDG
LVGVQLANGATLHSKTVILSTGARWREVNVSGEREYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLLEFGDALRADAVLVSKLKSLKNVDIHTQAQTTAITGAD
GKVNGLTYIDRASGESRRVELEGVFVQIGLVPNSEWLKGTLELSRHGEIVVDARGQTSLP
GVFAAGDVTTVPFKQIIIATGDGAKAALGAFDHLIRSSAPQAVAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccaacctgagggctcaactcaaggcgtacctcgagcgcgtgaaactgcct
ttcgaaatcatcgcctcgctggacgacagcgccgccgcccgggagatgcacggtctgttg
agcgacatcgtctcgctgtgtgacaagatcaccttgaggaccgatggcacggacgtccgc
aagccctctttcgcgctggccggcgccggcgaggcgccgcgcattcgtttcgcggcgatc
ccgttagggcatgaattcgcctcgctcgtgctggcgctgctgcaggtcggcggccacccg
ccaaagattgagaccgcactgatcgagcagatcaggaatctcgagggtgaattccgcttc
gagacctacatgtcgctgagctgtcacaactgccccgatgtcgtgcaggcgctgaacctg
atggcggtgctgaacccccgcgtgcacagtgtcgtgatcgacggcgccctgtaccagcag
gaggtgaccgagcgccaggtgatggcggtcccgatggtgttcctgaacggcgagcatttc
ggccagggccgcatggacgtcgaagagattgtcgccaggcttgataccggcaccgcggcc
cgcgatgcggccagactgaacgcgaagcaagcctacgacgtgctcatcgtcggtggtggc
ccggcaggggcggccgcggccgtttacgcggcgcgcaagggcatccgcaccggcatgctc
gccgagcgcctgggcggacagaccatggacacgatgggcatcgagaacttcgtctcggtg
ctcgagacggatgggccgaagttcgcggccgcgcttgagcagcatgccaggttgtacgag
gtggacatcctcaacctgcagcgtgccgagaagctgattccggccaccgacaacgacggc
ctggtcggcgtgcagctcgccaatggcgccaccctgcacagcaaaaccgtgatcctgtcg
accggcgcgcgctggcgcgaggtcaacgtgtcgggcgagcgggaataccgcaacaagggg
gtggcctactgtccgcactgcgacggcccgctgttcaagggcaagcgcgtggccgtgatc
ggcggcggcaactccggcgtcgaggcggcgatcgacctggccggcatcgttggccatgtc
acgctgctcgaattcggcgatgcgctgcgcgcagacgctgtgctcgtcagcaagctgaag
agcctgaaaaatgtcgatatccatacccaggcgcagacgaccgcgatcaccggggccgac
ggcaaggtgaatggtttgacctacatcgatcgggcgagcggcgaatcgcgccgcgtcgaa
ctcgaaggcgtgtttgtgcagatcggcctggtgccgaactccgagtggctcaagggaacg
ctggagctgtcgcgccatggcgagatcgtggtcgacgcgcgcggccagacttcgctgccg
ggcgtgttcgccgccggcgacgtcacgacggtgccgttcaagcagatcatcatcgcgacc
ggtgatggtgcaaaagcggcgctcggcgcattcgaccacctgattcgcagctcggcgccg
caggcggttgcggcctga

DBGET integrated database retrieval system