KEGG   Rhodoferax sp. CHu59-6-5: EUB48_05615
Entry
EUB48_05615       CDS       T06165                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rhf  Rhodoferax sp. CHu59-6-5
Pathway
rhf01040  Biosynthesis of unsaturated fatty acids
rhf01100  Metabolic pathways
rhf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rhf00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EUB48_05615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhf01004]
    EUB48_05615
Enzymes [BR:rhf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     EUB48_05615
Lipid biosynthesis proteins [BR:rhf01004]
 Desaturase
  First
   EUB48_05615
SSDB
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Other DBs
NCBI-ProteinID: QDL36829
UniProt: A0A515D8U2
LinkDB
Position
1164510..1165724
AA seq 404 aa
MLLPDWAVLNAGIDWLANGLWNLSWWEIVLYTLVTTHITIASVTIYLHRHQAHRALDLHA
IPAHFFRFWLWLATGQVTKEWVSIHRKHHAKCETIDDPHSPQAHGIKKVFWQGAELYRAE
SKNQETLSKYSQGCPNDWLERNVYTRYSWQGVGLMMIIDLALFGAAGLTVWAVQMVWIPF
WAAGVVNGVGHFWGYRNFEAPDASTNVSPWGIIIGGEELHNNHHTYPTSAKFSVKPYEFD
IGWGYIRLLEKAGLAHVKKTVPRLQLGAIQPVANEKTLEALIAHRYEVMAGYARDLRRAC
KAEIAALKARQGDVSELESARRWLHRDADKVPAGAVPQLAQARAAHPVLDKMVTMREELR
QLWLNTSQSREQLAADLAAWCHRAEESGIAALREFSIKLRAVRA
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgttattacctgactgggccgtgctgaacgcgggcatcgattggctcgccaacggattg
tggaacctgtcctggtgggaaatcgtgctgtacacgctcgtgaccacccacatcacgatc
gccagcgtgacgatctacctgcaccgccaccaggcgcaccgcgccctcgatctgcacgcg
attccagcgcattttttccgtttctggctctggctggcgactgggcaggtcaccaaggag
tgggtctcgatccaccgcaagcaccacgccaaatgcgaaaccatcgacgatccgcacagc
ccgcaggcgcacggcatcaagaaggtgttctggcagggtgccgagttgtaccgcgccgag
tccaaaaaccaggaaaccctgagcaagtacagccagggctgcccgaacgactggctcgag
cgcaacgtgtacacgcgctacagctggcagggcgtgggcctgatgatgatcatcgacctg
gcgctgtttggcgccgccggcctgaccgtgtgggcggtgcagatggtctggatcccgttc
tgggccgccggcgtggtcaatggcgtggggcacttctggggctatcgcaatttcgaggcg
ccggatgccagcaccaatgtgtcgccctggggcatcatcattggtggtgaagaactgcac
aacaaccaccacacctatccgacgtcggccaagttctcggtcaaaccctacgaattcgac
atcggctggggctatatcaggttgctggaaaaggccggcctggcccatgtcaagaagacc
gttcccaggctgcagctcggcgccatccagccggtggccaacgagaagacgctcgaagcg
ctgatcgcccaccgctacgaggtgatggcgggctacgcgcgcgacctgcgccgtgcctgc
aaggccgaaattgcggcgctcaaggccaggcagggcgatgtatcggagctggagtccgcc
cggcgctggctgcaccgagacgccgacaaggtgcccgctggcgccgtgccgcaactggcc
caggcccgcgccgcgcacccggtgctggacaagatggtgaccatgcgcgaagagctgcgc
cagctgtggctgaatacctcgcagtcgcgcgagcaactggccgctgatctggcggcctgg
tgtcaccgcgccgaggaaagcggcatcgctgccttgagagagttttccatcaagctgcgc
gccgtgcgtgcctga

DBGET integrated database retrieval system