KEGG   Rhodoferax sp. Gr-4: EXZ61_09490
Entry
EXZ61_09490       CDS       T06176                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rhg  Rhodoferax sp. Gr-4
Pathway
rhg03030  DNA replication
rhg03430  Mismatch repair
rhg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rhg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EXZ61_09490
   03430 Mismatch repair
    EXZ61_09490
   03440 Homologous recombination
    EXZ61_09490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rhg03032]
    EXZ61_09490
   03400 DNA repair and recombination proteins [BR:rhg03400]
    EXZ61_09490
Enzymes [BR:rhg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EXZ61_09490
DNA replication proteins [BR:rhg03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EXZ61_09490
DNA repair and recombination proteins [BR:rhg03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EXZ61_09490
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: QDL54377
UniProt: A0A515ENY3
LinkDB
Position
2025405..2025842
AA seq 145 aa
MTEVAFHFGAPDKLAYACRLLRKAAGSGASIVLVADSETLQFLDSALWGVSSTDFVPHCL
LGADLDIQRKSPVVLAPSVDGVALARDVLVNLGQLIPTGFESFKRVIEIVSTQESDRQLA
RDRWKQYAKGGFTIVRHDLQLKGAT
NT seq 438 nt   +upstreamnt  +downstreamnt
gtgacagaggttgcgtttcatttcggggcacctgacaagcttgcctacgcgtgtcgcttg
ctgcgcaaggccgctggctcgggtgcatctattgtgttggttgctgatagcgaaacgttg
cagttcctggacagtgcactctggggggtgtcaagcaccgactttgtgccacattgtctc
ttaggcgcagacctagacatacagcgcaagtcgcccgtcgttcttgcgccatcggtggac
ggcgtagcactcgctcgggatgtacttgtcaacctcggccagctaattcccactggcttt
gaaagcttcaaacgggtgatcgaaatagtcagcacccaagagtcggatcgtcagctggcc
cgggatcgctggaaacaatatgccaaaggtggcttcactattgttcgccatgaccttcag
ttgaaaggtgcgacctga

DBGET integrated database retrieval system