KEGG   Rhodoferax sp. Gr-4: EXZ61_11215
Entry
EXZ61_11215       CDS       T06176                                 

Gene name
tssK
Definition
(GenBank) type VI secretion system baseplate subunit TssK
  KO
K11893  type VI secretion system protein ImpJ
Organism
rhg  Rhodoferax sp. Gr-4
Brite
KEGG Orthology (KO) [BR:rhg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rhg02044]
    EXZ61_11215 (tssK)
Secretion system [BR:rhg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EXZ61_11215 (tssK)
SSDB
Motif
Pfam: T6SS_VasE CSTF1_dimer
Other DBs
NCBI-ProteinID: QDL54692
UniProt: A0A515EPU2
LinkDB
Position
complement(2435970..2437313)
AA seq 447 aa
MTWQNKVTWSEGLFLRPQLFQQQERYLESFAHRRAEPLSPFFWGFGQFRIDRESLTLGKL
VLATATGLFPDGTPFDLPGQTPPPPPLTLLPEHLEQIIYLALPIRTPNGEETTFESSPGS
LARFNVIDAELRDSNSIGQGAKIVQISQLRLQLIPQKELTSAWMGLPLAKLTALRSDGSA
ELDSTLIPPVNRYGASEQLTQWLGQLHGTTRQRADNLAQRLSGSAGSGATQAAEVSDFLL
LQILNRYEPLLDHLIRVKETSPEQAYILLRGMAGEISTFIRVQTRRPNPLPAYEHRDPYT
SFKALVEDTRELLNNLLVRSAQNIPLQEKQHGMQLASMDPQQLRGFHFLVLAVAANMPAE
QLAQNFTAHTKVAPADRLPELVRLHLPSLVLRVLPVPPRQIPFNAGYVYFQIEPQGPLWE
HMLTHGGIGLHVATQLPGLQIELWGVR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgacctggcaaaacaaagtcacttggagcgaaggcctcttcctgcgcccgcaactattt
caacaacaagagcgctacctagagagctttgcccataggcgcgctgagccactgtctccc
ttcttctggggctttggccagttccgtatcgaccgcgaatcattgacgctgggcaaactc
gttctggccacggccaccggcctgttccctgacggcacaccctttgatctgcccggacag
actccgccgcctccgcccttgaccctgctgccagagcacctggagcaaatcatctatctg
gcgctgcccattcgtacaccgaacggggaagaaaccaccttcgaatcctcgcccggctcg
ctggcgcgattcaacgtcatcgatgccgagctgcgcgattccaactctatagggcaaggc
gcgaagattgttcaaatatcccagctgcgcctacagctcattccgcagaaagaactcacc
agcgcctggatggggcttccgctggccaaactgaccgcactgcgctcagacggcagcgcc
gaactggacagcacgctcatccccccagtcaaccgctatggcgccagtgaacagctcacc
caatggctggggcagttgcacggcacgacaagacagcgtgcagacaacctcgcacagcgc
ttgagcggaagcgccggcagtggcgcaacccaagctgcagaagtcagcgacttcctcctc
ttgcaaatcctcaaccgctacgaacccttgctcgaccacctcattcgggttaaagaaaca
tcccccgagcaagcctacatcctgttgcgaggcatggctggcgagatatccaccttcatc
cgagttcagacgcgacgccccaaccccctgcctgcttacgagcaccgcgacccctacacc
agcttcaaagcactggtcgaagacacccgcgaactgctcaacaacctcctggtgcgcagc
gcccaaaacatcccgctgcaagaaaagcaacatggcatgcaactcgccagcatggaccct
cagcaactgcgcggcttccacttcctggtgctggccgttgccgccaacatgcccgccgag
caactggcgcaaaactttacggcccacaccaaagtcgcgccagcagaccgccttccagaa
ctggtgcgactgcacctgcccagccttgtcttgcgcgtgctgccagtgccgccacgccaa
ataccgttcaacgcaggctacgtttacttccagatcgaaccacaaggccccctgtgggag
cacatgctcacccacggtggcattggtttgcacgtcgcaacccaactgccgggcttgcaa
attgaactatggggcgtgcgctaa

DBGET integrated database retrieval system