KEGG   Rhodoferax sp. Gr-4: EXZ61_13405Help
Entry
EXZ61_13405       CDS       T06176                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rhg  Rhodoferax sp. Gr-4
Brite
KEGG Orthology (KO) [BR:rhg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EXZ61_13405 (ahpF)
Enzymes [BR:rhg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EXZ61_13405 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA DAO HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Glutaredoxin Thi4 K_oxygenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QDL55083
UniProt: A0A515EQZ7
LinkDB All DBs
Position
complement(2919718..2921286)
Genome map
AA seq 522 aa AA seqDB search
MLDDTLKSQLGAYLERVTLPIEMVASLGDDDNSAQMRELLQTIQSLRADKISVAYDGTDA
RKPSFSLQRAGTDTSLRFAGLPLGHEFTSLVLALLWSGGHPPKVEQVLIEQIKALSPAHG
GDFNFEVYMSLTCHNCPDVVQALSLMAIFNPKVKTTVIEGGAFQDEVNAREIMAVPSVYL
NGALFGNGRMLVEEIVAKLDTGAADKDAAKLSAKDPYDVLIVGGGPAGAAAAVYAARKGI
RVGVAAERFGGQTNDTMAIENYPSVQETDGPKFAAALEAQTRSYGVDIMNLQRADKIVPA
AEAGGLTEVVLANGGTLKAKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGK
DVAVIGGGNSGIEAAIDLAGVVKYVTVIEFADQLKADAVLVKKLHSLPNVTVHTNAQTTE
ITGADGKVNGLKYKDRATGVEHHIALEGVFVQIGLVPNTEFLKGVVDLSKFGEIVVDSRG
HTNVPGVFAAGDCTTVPYKQIVIAASEGSKAALSAFDHLIRH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacacactcaaatcccaactcggcgcttacctggagcgcgtaacgctgccg
atcgagatggtggcgtcccttggtgatgacgataactccgcgcaaatgcgtgagctgttg
cagaccattcagagcctgcgcgccgacaaaatttcggtcgcctacgacggcaccgacgcc
cgcaagccctcgttcagccttcaacgggctggcacagatacttctttaagatttgccggt
ctgcctctggggcatgagttcacctccttggtactggccctgttgtggagtggtggccac
ccgcctaaggttgagcaagtcctcatcgaacagatcaaggctttgtcccctgcgcacggc
ggtgacttcaacttcgaggtctacatgagcctcacctgccacaactgcccggacgtggtg
caagcgctaagcctcatggcgatttttaaccccaaggtcaaaactaccgtgattgaaggc
ggcgcgttccaagacgaagtgaatgcccgcgaaatcatggccgtgcctagcgtctacctc
aacggcgcgttgtttggcaacggccgcatgctggtagaagaaattgtggccaagctcgac
accggcgctgccgacaaagacgcggccaaactgtctgccaaagacccgtatgacgtgctc
atcgtcggcggtggccctgcaggtgcagcagctgcggtgtacgccgcccgcaaaggcatc
cgcgtgggtgtggcggccgagcgctttggcggtcagaccaacgacaccatggccatcgag
aactacccctcggtgcaagaaaccgatggccccaagttcgctgccgccctggaagcccag
acccgctcgtatggcgtagacatcatgaacctgcagcgcgccgacaaaatcgtgcccgcc
gcagaggctggaggcttgaccgaagtggtgctggccaacggtggcacgctcaaggccaag
accgtgatcttgtccaccggcgcccgctggcgcaatgtcaatgtgccgggtgaggccgag
tacaaaaacaaaggcgtggcctactgcccgcactgcgacggccccttgttcaagggcaaa
gacgtggcggtgattggtggcggcaactccggcatcgaagccgctatcgacctggccggc
gtggtcaagtacgtgacggtgattgagttcgccgaccagctgaaggccgacgccgtgctg
gtcaaaaagctgcacagcctgcccaatgtgaccgtgcataccaacgcccagaccaccgag
atcaccggtgcggacggcaaggtgaacggtctgaagtacaaagaccgcgccaccggcgtg
gagcaccacattgcgctggaaggcgtgtttgtgcaaatcggcctggtgcctaacaccgag
ttcctgaagggcgtggtggacctgagtaagttcggcgaaatcgtggtggattcacgcggc
cacaccaacgtgcccggcgtgtttgccgctggcgactgcaccaccgtgccctacaagcaa
atcgtgattgcagccagcgaaggctccaaggccgcgctgagtgcgtttgaccacttgatc
cggcactga

DBGET integrated database retrieval system