KEGG   Rheinheimera sp. D18: E0Z06_02895Help
Entry
E0Z06_02895       CDS       T05923                                 

Definition
(GenBank) MarR family transcriptional regulator
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
rhh  Rheinheimera sp. D18
Brite
KEGG Orthology (KO) [BR:rhh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rhh03000]
    E0Z06_02895
Transcription factors [BR:rhh03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    E0Z06_02895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_Crp_2 HTH_34 DUF3116 DUF4364 B-block_TFIIIC HxlR HTH_20 HTH_24 GntR PadR DUF4362
Motif
Other DBs
NCBI-ProteinID: QBL08535
LinkDB All DBs
Position
complement(608452..608925)
Genome map
AA seq 157 aa AA seqDB search
MAHLTTELSLAERLGRLHRLWRTVADAELIPLGLTHPRWTALWKISQLGDGVSQKVLADA
LEIELASLMRTLNQLEQQQFIIRRSCTNDKRARVVSLTDAGVEILKQMETHIVRVRGELL
ASVNEQELTEFSRVLAVITDNALTKLANNTVRCNEKR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcccacctcactactgaattatcacttgccgaacgcttagggcgtttacatcgccta
tggcgcacagtggccgacgccgaattaattccgctgggtttaacccatccgcgctggaca
gcgctgtggaaaattagccaactaggcgatggcgtaagccaaaaggtattagctgatgcg
ctagaaattgagctagcttcgttaatgcgtactttaaaccagttagaacagcagcagttt
attattcgccgcagctgtactaacgacaaacgcgcgcgggtagttagcctaaccgatgcc
ggcgtagagatattaaaacaaatggaaactcatatagtcagggtacgcggcgaattatta
gccagcgttaacgagcaggaactaacagaatttagccgcgtactcgcggttattaccgac
aacgcattaactaaactcgccaacaacacggtacgctgtaatgaaaaacgctag

DBGET integrated database retrieval system