KEGG   Rheinheimera sp. D18: E0Z06_12930Help
Entry
E0Z06_12930       CDS       T05923                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
rhh  Rheinheimera sp. D18
Pathway
rhh00260  Glycine, serine and threonine metabolism
rhh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E0Z06_12930
Enzymes [BR:rhh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     E0Z06_12930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_binding_2 Pyr_redox_2 Pyr_redox_3 FAD_oxidored Pyr_redox
Motif
Other DBs
NCBI-ProteinID: QBL10366
LinkDB All DBs
Position
complement(2733346..2734371)
Genome map
AA seq 341 aa AA seqDB search
MKALAKLKAEPGIWQTEVDKPEVGPNDVLIRIKKTAICGTDVHIYKWDEWAQNTIPHGMV
VGHEYVGVIEGMGSEVRGFKVGDRVSGEGHITCGYCRNCRAGRVHLCRNTTGVGVNRPGA
FAEYLVIPAYNAFKLADNIPDNIAAIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVARHVGARHVVITDVNQYRLDLALKMGATRAVDVSKQNLKDVMNELGMTEGFDVGLEMS
GVPAAFRSMLDTMNHGGKIAMLGIPPSDMAVDWNKVIFKGLVIKGIYGREMFETWYKMAS
LIQSGLDLTPMITHEMPMENYQEGFEIMCSGQSGKVILNWS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattagcaaagttaaaagcagaaccgggtatttggcaaactgaagttgataag
ccagaagtcggcccgaatgatgtattaatacgtattaaaaaaaccgctatttgcggtacc
gacgtacatatttataaatgggatgagtgggcacaaaacacgattccacatggcatggta
gtaggtcatgagtatgttggtgtaattgaaggcatgggttcagaagtgcgtggttttaaa
gtaggtgaccgcgtgtcgggtgaaggccatattacctgtggttattgccgtaactgtcgg
gctgggcgagtacatttatgccgtaacaccacaggtgttggtgttaaccgtccgggtgct
tttgccgagtacttagtcatcccagcgtataacgcgtttaaattagctgacaatattcct
gacaatatcgcggctatttttgacccgttcggtaatgccgtgcataccgcactgtcgttc
gatttagtgggtgaagacgtgcttattaccggtgctgggccaatcggcattatggcagca
gccgtagcgcgacacgttggcgcccggcatgtggttataactgatgtaaaccaataccgc
ttagatttagcgcttaaaatgggtgctacccgtgccgtagacgttagtaaacaaaaccta
aaagacgtgatgaacgaactgggtatgaccgaaggttttgatgttggtctggaaatgtcc
ggtgtgccagccgcgtttcgtagcatgcttgataccatgaatcacggtggcaaaattgcg
atgctaggtattccgccgtctgatatggcagtagattggaataaagttatttttaaaggc
ttagtaatcaaaggtatttacggtcgcgagatgtttgaaacttggtacaaaatggccagt
ttaattcagtcggggttagatttaacgccaatgattactcatgaaatgccgatggaaaac
taccaagaaggtttcgagattatgtgttctggtcagtcaggtaaagtaattctgaactgg
tcataa

DBGET integrated database retrieval system