KEGG   Rheinheimera sp. D18: E0Z06_14655Help
Entry
E0Z06_14655       CDS       T05923                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rhh  Rheinheimera sp. D18
Brite
KEGG Orthology (KO) [BR:rhh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E0Z06_14655 (ahpF)
Enzymes [BR:rhh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E0Z06_14655 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 HI0933_like GIDA FAD_oxidored Thi4 Glutaredoxin AlaDh_PNT_C DAO NAD_binding_8 FAD_binding_3 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QBL10670
UniProt: A0A4P6VW74
LinkDB All DBs
Position
3127764..3129308
Genome map
AA seq 514 aa AA seqDB search
MLDTNLKQTLKTYLQNLKTQVELVVSLDDSAKATEVHTLATEIAELSDLVSLRRDDTAMA
RKPAMLVRSVANNTHITFAGVPLGHEFTSLVLALLHSGGHPIKVEADVIEQIRQLPGNFA
FETYVSLSCQTCPEVVQALNIMSAINPNITNVMIDGAMFQQEVADKNIMAVPSVYLNGEL
FSQGAITLEKIIQKLDVNAEKRQAEALKNKADFDVLVVGGGPAGAAASIYAARKGLNTGI
VAERFGGQVADTVGIENFISVKYTEGPKLVNSLEAHVREYNVDIMNNQRAVKLSKDGKVQ
LELQNGAVLKSKTIILSPGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKKVAVIGGG
NSGIEAAIDLAGIVEHVTVLEFAAELRADAVLVKKANSMGNITIITEAQSTEVTGDGSRV
TGINYTDRKTGNAHHVELAGIFVQIGLVPNTEWLRGAIELSSRGEIIIDERGQTSMPGVF
AAGDATTAPFKQIIIAMGSGATAALGAFDYMIRN
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttagatactaacctgaagcaaacacttaaaacctatctacaaaacttgaaaacacag
gttgaactggtggtatctttagacgatagcgccaaagcaactgaagtacacaccttagca
actgaaattgctgagttatcagatttagtgtcattgcgtcgcgatgatactgctatggca
cgcaagccagctatgttggtgcgttcggtagcaaacaacacccacatcacctttgccggt
gtaccactggggcatgaatttacctcattagtgttagcactgctgcactctggcggccac
ccaattaaagtagaagccgatgttattgagcaaattcgccagctgccaggcaacttcgcg
tttgagacctatgtatcactaagttgccaaacctgccctgaagtagtgcaagcactaaac
atcatgtcggccattaaccctaacattactaacgtaatgatcgacggtgcaatgttccag
caagaagtagctgataaaaacattatggccgtaccttcggtttacctaaatggtgagcta
ttttcgcaaggtgccattacgctagaaaaaattattcaaaaacttgatgttaatgcagaa
aaacgtcaagccgaagcgctgaaaaacaaagcagactttgatgtattagtggttggtggc
ggcccagcaggtgcagcagcctctatttacgctgcacgtaaaggcttaaacaccggcatt
gtggctgagcgttttggcggccaagtcgcagataccgtaggtatcgaaaactttatttcg
gtaaaatataccgaaggtccaaagttagttaatagcttagaagcgcacgtacgtgagtac
aacgtagatattatgaacaatcaacgcgcagtaaaactaagcaaagatggcaaggtacag
ctagagctgcaaaatggcgcggtacttaaaagtaaaaccattattttaagcccaggtgca
cgctggagagaaatgaacgtacccggcgagcaagagtatcgtggcaagggcgtggcttac
tgcccgcattgtgacggcccgctgtttaaaggcaaaaaagtcgcggtaattggcggtggt
aactcaggtattgaagccgcaattgacctagccggcattgttgaacacgttaccgtatta
gaatttgctgccgaactgcgtgccgatgcggtactagttaaaaaagccaattcaatgggc
aacattaccattattaccgaagcgcaaagtaccgaagtaaccggtgatggcagccgcgta
accggcattaactataccgaccgtaaaacgggtaatgcacaccatgtagaattagccggt
atttttgtacaaattggtttagtgccaaataccgaatggttacgtggcgcaatagagctg
tcatctcgtggtgaaattattattgacgagcgcggccaaacctcaatgccaggcgtattt
gccgctggtgatgctactaccgcaccatttaagcaaattattattgctatgggttcaggc
gccaccgccgcattaggtgcctttgactatatgatccgtaactaa

DBGET integrated database retrieval system