KEGG   Sinorhizobium fredii NGR234: NGR_b02480Help
Entry
NGR_b02480        CDS       T00888                                 

Definition
(RefSeq) two-component response regulator protein
  KO
K02483  two-component system, OmpR family, response regulator
Organism
rhi  Sinorhizobium fredii NGR234
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rhi02022]
    NGR_b02480
Two-component system [BR:rhi02022]
 OmpR family
  Unclassified
   NGR_b02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C LisH
Motif
Other DBs
NCBI-GeneID: 7789786
NCBI-ProteinID: YP_002822467
RhizoBase: NGR_b02480
UniProt: C3KNQ6
LinkDB All DBs
Position
pNGR234b:complement(244906..245643)
Genome map
AA seq 245 aa AA seqDB search
MEHIDHILIVDDDREIRELVSSYLKKNGLRATAVADGRQMRAFLDGNTVDLIILDLMMPG
DDGLVLSRELRVGRHKATPIVMLTARSDEMDRIIGLEMGADDYLAKPFSARELLARIKAV
LRRARMLPPNLQISEAGQLLGFGEWRLDTTARHLIDADGTVIALSGAEYRLLRVFVDHPQ
RVLNRDQLLNLTQGREAELFDRSIDLLVSRVRQRLGDDARDPTYIKTVRSEGYVFSMPVE
ILEPR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagcatatcgatcacatcttgattgtcgatgacgatcgggaaatccgggagcttgtg
tcgagctacctgaagaagaacggtctgcgcgctaccgcggtcgccgacgggcgacagatg
cgcgcgttcctcgatggaaataccgtcgatctcatcattctcgacctcatgatgccggga
gatgacggtctggtgctcagtcgcgagctgcgcgtcggcagacacaaggcgacaccgatt
gtcatgctgactgcccgctccgacgagatggaccgcatcatcgggctggaaatgggcgcc
gacgactacctcgccaagcctttttcggcgcgcgagttgctcgcccgcatcaaagccgtc
ctgcggcgcgcgcgcatgctgcctccgaacttgcagatctcggaagccgggcaattgctg
ggcttcggtgagtggaggctagacacgacggcgaggcatctgatcgacgccgacggcacc
gtgatcgcgctcagcggcgccgagtaccggctgctgcgcgtcttcgtcgatcacccgcag
cgtgtcctcaatcgcgaccagctgctcaatctgacgcagggacgcgaggccgaactcttc
gaccgttccatcgatctcctcgtcagccgggttcgccagcgccttggcgatgatgcccgc
gacccgacctacataaagacggtgcgcagcgaaggttacgttttctcgatgccggtcgaa
atcttggagccgcgttga

DBGET integrated database retrieval system