KEGG   Sinorhizobium fredii NGR234: NGR_b06320Help
Entry
NGR_b06320        CDS       T00888                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NGR_b06320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhi02000]
    NGR_b06320
Enzymes [BR:rhi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NGR_b06320
Transporters [BR:rhi02000]
 Other Transporters
  Pores ion channels [TC:1]
   NGR_b06320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Tom37
Motif
Other DBs
NCBI-GeneID: 7788371
NCBI-ProteinID: YP_002822843
RhizoBase: NGR_b06320
UniProt: Q6W112
LinkDB All DBs
Position
pNGR234b:630966..631577
Genome map
AA seq 203 aa AA seqDB search
MKLYYHPLSGHAHRARLLLTLLGLEHDLVLVDLAGREHKQEPFLKLNPFGQVPVLDDDGT
IICDSNAILVYLAKKAGRTDWLPEDPRAAAAVQRWLSVAAGQIAHGPAQARLITVFKAPY
RPEEVIPRSHAILTLIEDALEAGDWIAADRPTIADVALYSYVARAPEGDVDLQPYANIRG
WLERIEALPGFVDFQKTPVGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttactatcatccgctgtccggccatgcgcatcgcgcccggctcctactcacg
ctgctcggtctcgagcatgacctcgtgctcgtcgatctcgctggaagagaacacaagcag
gagccgttcctgaagctcaatccgttcggccaggttccggtgctcgatgacgacggcacg
atcatctgcgattccaacgccattctcgtctatctagccaagaaggcaggccgcacggac
tggttgccggaagacccgcgagccgcggccgccgtgcaacgctggctgtcggtcgccgcc
ggccagatcgcccatggtccggcgcaggcgcggctcatcaccgtgttcaaagccccctac
aggccggaagaggtcatccctcgctcccacgccatcctgacattgatcgaggatgcgctc
gaagccggggactggattgctgccgaccgcccgaccatcgccgatgtggcgctttacagc
tatgtggcgcgagcgcccgaaggcgacgtggatcttcagccctatgcgaatatccgcggc
tggctcgagcgcatcgaagcgttgccgggcttcgtcgacttccagaaaaccccggttggt
ctcgccgcctga

DBGET integrated database retrieval system