KEGG   Sinorhizobium fredii NGR234: NGR_b13670Help
Entry
NGR_b13670        CDS       T00888                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00250  Alanine, aspartate and glutamate metabolism
rhi00410  beta-Alanine metabolism
rhi00640  Propanoate metabolism
rhi00650  Butanoate metabolism
rhi01100  Metabolic pathways
rhi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NGR_b13670
   00650 Butanoate metabolism
    NGR_b13670
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NGR_b13670
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NGR_b13670
Enzymes [BR:rhi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NGR_b13670
Amino acid related enzymes [BR:rhi01007]
 Aminotransferase (transaminase)
  Class III
   NGR_b13670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 7787915
NCBI-ProteinID: YP_002823571
RhizoBase: NGR_b13670
UniProt: C3KRW0
LinkDB All DBs
Position
pNGR234b:complement(1365739..1367007)
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKESNRYIDFAAGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNALAPGKFAKKTIFVTTGAEAVENAVKIAR
AATGRQAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVSVEQS
LAALKKLFAADVDPGRVAAIILEPVQGEGGFYPAPTAFMKALREICDQHGILLIADEVQT
GFARTGKLFAMEHHDVAPDLMTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPI
GIAAAHAVLDVIEEEQLCERANQLGNRLKQRLAQIREKAPEIVDIRGPGFMNAVEFNDVK
TKLPSAEFANKVRLIALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDILEASILEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaccgcaagaacgccgccatatcccgcggtgtgggaatgaccacg
cagatctacgctgaccgcgccgaaaatgcagagatctgggacaaggaaagcaatcgctat
atcgatttcgccgcgggtatcgccgtcgtcaacaccggtcaccgccatccgaaggtgatc
gctgccgtcaaggcacagctcgaccgcttcacccacacctgccaccaggtggtcccctat
gagaactacgtgcatctggccgagcgcctcaacgcgctggcccccggcaagttcgcgaag
aagacgattttcgtcaccaccggcgccgaagcggtcgagaacgcggtgaagatcgcccgc
gccgcgacgggacggcaggccgtcatcgccttcggcggcggcttccacggccgcaccttc
atgggcatggcgctgaccggcaaggtggtgccctacaaggtcggcttcggcgcgatgccg
gccgacgtgttccatgcccccttcccgatcgagctccacggcgtcagcgtcgagcagtcg
ttggcggcgctgaagaagctctttgccgccgatgtcgatccgggccgcgtcgcggcgatc
atcctcgagccggtccagggcgaaggcggcttctatccagctccgaccgcattcatgaag
gcgctccgcgaaatctgcgaccagcacggcatcctgttgatcgccgacgaagtccagacc
ggctttgcccggaccggcaagctcttcgcgatggagcatcacgacgtcgctccggacctg
atgacgatggccaagagccttgccggcggcttcccgcttgccgcggtcacaggccgcgcc
gaaatcatggatgcgccgggaccgggcggtctcggcggcacctatggcggcaacccgatc
ggcatcgccgcggcgcatgccgtcctcgacgtgatcgaggaagaacaactttgcgagagg
gccaaccagctcggcaaccgtctgaagcagcgtcttgcgcagatccgcgaaaaggcgccc
gagatcgtcgacattcgtggtccaggcttcatgaacgcggtcgaattcaacgacgtgaag
acgaagctgccgagcgccgaattcgccaacaaggtccgcctgatcgcccttgaaaaagga
ttgatcctgctgacttgcggcgtgcatggcaatgttatccgcttcctggcgccgatcacc
atccaggacgaggtctttgccgaggcgctcgatatcctcgaggcatcgatcctcgaagcg
cgcggttga

DBGET integrated database retrieval system