KEGG   Sinorhizobium fredii NGR234: NGR_b19380Help
Entry
NGR_b19380        CDS       T00888                                 

Gene name
pdhB1
Definition
(RefSeq) acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00020  Citrate cycle (TCA cycle)
rhi00620  Pyruvate metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
Module
rhi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_b19380 (pdhB1)
   00020 Citrate cycle (TCA cycle)
    NGR_b19380 (pdhB1)
   00620 Pyruvate metabolism
    NGR_b19380 (pdhB1)
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NGR_b19380 (pdhB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 7789260
NCBI-ProteinID: YP_002824138
RhizoBase: NGR_b19380
UniProt: C3KLU9
LinkDB All DBs
Position
pNGR234b:complement(1978758..1980050)
Genome map
AA seq 430 aa AA seqDB search
MATEVILPKVDMDMATGKISKWFFGEGDAVKEGDVLFEIETDKAAMEIDAPASGVLHNVT
GKEGVDIPVGSAVAWIYAEGEAVNETAVPLTASDAVQSSLPVSETKTSAAEVAVERNAGG
AVRATPLARRLARERGLDLSTLAASGPHGRVVSADVLAASNTVADAWVQAEPTRTSGRSE
AGNNIVGENTLRHFPDGSYELQAHTSMRRTIARRLVEAKSTVPHFYLSADCRLDALLKLR
AELNAAAPLVESVPAYKLSVNDLVIKAYALALIGVPDANVSWTDEHLVRHSHSDVGVAVS
VPGGLITPIIRQAEQKSLSTISNEMKDLALRAKAGKLKPNEYQGGTGAVSNLGMYGVKEF
AAIINPPHSTILAVGAGEKRPMVTAEGELGVATVMSVTLSTDHRAVDGALGAELLAKFRA
LIENPLSILV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaagtcattttgccgaaggtcgacatggacatggcgacgggcaagatctca
aagtggttcttcggcgagggcgatgccgtcaaagaaggcgacgtccttttcgagatcgag
accgacaaggcggctatggaaatcgacgcacccgcgagcggagtcctgcataacgtgacc
ggtaaggagggtgtggatatccccgtcggctcggccgtcgcgtggatctatgccgagggg
gaggccgttaacgagacggccgtccctctgacggcgtcggacgccgtccaaagctcgctc
ccggtgtccgaaacgaagacgtcggccgcagaggtcgcagtcgaacggaacgctggaggc
gcagtccgcgccacgccgctcgcacggcgcctcgcacgggaacgcggactggatctttcc
accctggcggcgagcggccctcatggccgcgtcgtcagtgccgatgtgctggcggcctcc
aacaccgttgctgatgcctgggtacaggcggagcccacccggacatcgggtagatcggag
gccggcaataacatcgtaggcgagaacacgcttcggcattttcccgatgggtcctacgaa
cttcaggcgcacacctccatgcgtcggacaatcgcccggcggctcgtcgaggccaagagc
actgttccgcacttctacctttcggcagactgccgtctcgatgcgctcctgaaattgcgt
gcggagcttaatgctgcggcgccgctggtagagagcgtaccggcctacaagctctcggtg
aacgacctcgtcatcaaggcctacgcgctagccctgatcggtgttccggacgctaacgtg
tcgtggacggacgagcatctggtgcgccacagccactcggatgtcggagtcgcggtttcc
gttcccggtggacttatcaccccgatcatccgccaggcggagcaaaagagcctgtcgacc
atttcgaacgagatgaaggacttggccctgcgtgccaaggcaggaaagctgaagccgaac
gaataccagggcggtacgggagcggtgtcaaacctcggaatgtacggcgtgaaggagttc
gccgcgatcatcaatcccccacactccacgattctggcggtcggcgccggagaaaagcgg
ccgatggtaaccgcagagggggagttgggcgttgctactgttatgagcgtgacgctgtcc
acggaccatcgtgccgtggatggtgcgcttggcgcagagcttctcgcgaagttccgcgcg
ctcatcgagaacccattgagcatactggtctag

DBGET integrated database retrieval system