KEGG   Sinorhizobium fredii NGR234: NGR_c01470Help
Entry
NGR_c01470        CDS       T00888                                 

Definition
(RefSeq) phosphate transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NGR_c01470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhi02000]
    NGR_c01470
Enzymes [BR:rhi01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     NGR_c01470
Transporters [BR:rhi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    NGR_c01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_22 AAA_33 AAA_29 AAA_16 AAA_30 AAA_18 Rad17 AAA_25 AAA_23 AAA_24 PRK NACHT Adeno_IVa2 AAA_28 AAA_5 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 7790726
NCBI-ProteinID: YP_002824702
RhizoBase: NGR_c01470
UniProt: C3MFB2
LinkDB All DBs
Position
167738..168553
Genome map
AA seq 271 aa AA seqDB search
MNIMSEAAVEKALDQKMNTVPLKMIGKDVSVYYGEKRALFDVNLNIRENTVTALIGPSGC
GKSTFLRTLNRMNDTIENCRVTGRITLDEDDIYDPSIDVVELRARVGMVFQKPNPFPKSI
YENVSYGPRIHGLARTKADFDEIVETSLQKAGLWNEVKDRLQEPGTGLSGGQQQRLCIAR
AVAVSPEVILMDEPCSALDPIATAKVEELIHELRANFTIVIVTHSMQQAARVSQRTAMFH
LGNLVEENDTDKMFTNPDDQRTQDYIMGRFG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatgtcggaagctgcagtcgaaaaggctctggaccagaaaatgaatacggtg
cccttgaagatgatcggcaaggatgtgtcggtctattacggcgagaagcgcgcgcttttc
gacgtcaacctgaatatccgcgagaacacggtgacggcgctgatcggtccgtccggctgc
ggcaagtcgaccttcctgcgtacgctcaaccgcatgaacgacacgatcgagaattgccgc
gtcaccggccggatcaccctcgacgaggacgacatctacgatccgtcgatcgacgtggtg
gaactgcgcgcccgtgtcggcatggtgttccagaagcccaatccgttcccgaagtcgatc
tacgagaacgtctcctacgggccgcgcatccatggcctcgcccgcaccaaggccgatttc
gacgagatcgtcgaaacgagcctgcagaaggccggcctgtggaacgaggtgaaggatcgt
ctgcaggagccggggacgggtctttccggcggccagcagcagcgcctctgcatcgcccgt
gccgtcgccgtcagcccggaagtgatcctgatggacgagccctgctcggcccttgacccg
attgccaccgccaaggtcgaagagcttattcacgagctgcgcgccaatttcaccatcgtc
atcgtcacccattcgatgcagcaggccgcccgcgtttcgcagcgcaccgccatgttccac
ctcggcaatctcgtcgaggagaacgataccgacaagatgttcaccaatccggacgaccag
cgcacgcaggattacatcatgggccgcttcggctga

DBGET integrated database retrieval system