KEGG   Sinorhizobium fredii NGR234: NGR_c11730Help
Entry
NGR_c11730        CDS       T00888                                 

Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rhi  Sinorhizobium fredii NGR234
Brite
Translation factors [BR:rhi03012]
 Eukaryotic Type
  Elongation factors
   NGR_c11730
 Prokaryotic Type
   NGR_c11730
Mitochondrial biogenesis [BR:rhi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NGR_c11730
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NGR_c11730
  Exosomal proteins of breast cancer cells
   NGR_c11730
  Exosomal proteins of colorectal cancer cells
   NGR_c11730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 7793046
NCBI-ProteinID: YP_002825709
RhizoBase: NGR_c11730
UniProt: C3MAW3
LinkDB All DBs
Position
1222019..1223194
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPVDLPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQVLCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgagcgcaacaagccgcacgtcaacatcggcacgattggccac
gttgaccatggcaagacgtcgctgacggcagcgatcaccaagtacttcggcgaattcaag
gcgtatgaccagatcgacgctgcgccggaagaaaaggcccgtggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccggcccgccactatgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtg
gtttcggccgccgacggcccgatgccgcagactcgcgagcacatcctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcttgaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcgtcaagggctcggcgctcgccgctctcgaagacagcgacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggtcgacgcctacatcccgacgccg
gaacgtccggtcgacctgccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggcacggtcgtcaccggccgcgttgagcgcggcatcgtcaaggtgggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggtgcgctcttgcgcggtgtcgac
cgcaacggcgtcgagcgcggccaggttctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggccgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtgacg
ctgccggaaggcaccgaaatggtgatgccgggcgacaacgtgacggtcgacgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgctatccgtgaaggcggccgcacc
gtcggcgccggcatcgtcgcctcgatcgtcgagtaa

DBGET integrated database retrieval system