KEGG   Sinorhizobium fredii NGR234: NGR_c11890Help
Entry
NGR_c11890        CDS       T00888                                 

Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rhi  Sinorhizobium fredii NGR234
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rhi03012]
    NGR_c11890
   03029 Mitochondrial biogenesis [BR:rhi03029]
    NGR_c11890
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhi04147]
    NGR_c11890
Translation factors [BR:rhi03012]
 Eukaryotic Type
  Elongation factors
   NGR_c11890
 Prokaryotic Type
   NGR_c11890
Mitochondrial biogenesis [BR:rhi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NGR_c11890
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NGR_c11890
  Exosomal proteins of breast cancer cells
   NGR_c11890
  Exosomal proteins of colorectal cancer cells
   NGR_c11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 7793062
NCBI-ProteinID: YP_002825724
RhizoBase: NGR_c11890
UniProt: C3MAX8
LinkDB All DBs
Position
1241128..1242303
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDLPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQVLCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgagcgcaacaagccgcacgtcaacatcggcacgattggccac
gttgaccatggcaagacgtcgctgacggcagcgatcaccaagtacttcggcgaattcaag
gcgtatgaccagatcgacgctgcgccggaagaaaaggcccgtggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccggcccgccactatgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtg
gtttcggccgccgacggcccgatgccgcagacccgcgagcacatcctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagctggaagtgcgcgaactcttgtcgtcctatgaattcccgggc
gacgacattccgatcatcaagggctcggcgctggccgctctcgaagattccgacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggttgacgcctacatcccgacgccg
gagcgtccgatcgacctgccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggcacggtcgtcaccggccgcgtcgagcgcggcatcgtcaaggtcggcgaggaaatc
gagatcgtcggcatccgtccgacgaccaagacgacctgcaccggcgttgaaatgttccgc
aagctgctcgaccagggccaagccggcgacaacatcggcgcgctgctgcgcggtgtcgac
cgcaacggcgtcgagcgtggccaggttctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggccgaagcctacatcctgacgaaggaagagggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgacg
ctgccggaaggcaccgaaatggtgatgccgggcgacaacgtgacggtcgacgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgcgatccgtgaaggcggccgcacc
gtcggcgccggcatcgtcgcctcgatcgtcgagtaa

DBGET integrated database retrieval system